DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRD2

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001382354.1 Gene:ADGRD2 / 347088 HGNCID:18651 Length:982 Species:Homo sapiens


Alignment Length:339 Identity:79/339 - (23%)
Similarity:129/339 - (38%) Gaps:85/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 HLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILT-----------ISVYLY-VEK--- 235
            ||..:..|....||  |.|......|.|....::.:.:..|           |.:.:| |::   
Human   628 HLQHRAQSPLFPPH--PPSPYTGGAWATTGCSVAALYLDSTACFCNHSTSFAILLQIYEVQRGPE 690

  Fly   236 ----LRNLH----GKCFICYLASLFLGYF-------------------------FLVLNVW-KYS 266
                ||.|.    |..| |.|.:.||.:.                         ||:.:.| |.:
Human   691 EESLLRTLSFVGCGVSF-CALTTTFLLFLVAGVPKSERTTVHKNLTFSLASAEGFLMTSEWAKAN 754

  Fly   267 SGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTA 331
            ...||......:|..:.||.|:.|.|:.|..|....|  :|   |....|.|:...||:|:.:.|
Human   755 EVACVAVTVAMHFLFLVAFSWMLVEGLLLWRKVVAVS--MH---PGPGMRLYHATGWGVPVGIVA 814

  Fly   332 ITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFN------IIMFVLSAIYI 390
            :|..   ::.::.:.|     .:||:......:.. |.||:|.::..|      ::|..:|    
Human   815 VTLA---MLPHDYVAP-----GHCWLNVHTNAIWA-FVGPVLFVLTANTCILARVVMITVS---- 866

  Fly   391 YNIKKNVKGLVHKQQTNQQINDQQMFAI--FLRLFILMGLSWSFEILSFLLTKQQAWARALMVAD 453
             :.::..:.|..:....|||..|....:  .|.|..::||:|...||..|   ..|||.|   |.
Human   867 -SARRRARMLSPQPCLQQQIWTQIWATVKPVLVLLPVLGLTWLAGILVHL---SPAWAYA---AV 924

  Fly   454 YFNWSQGTIIFVLF 467
            ..|..||..||:::
Human   925 GLNSIQGLYIFLVY 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 5/14 (36%)
7tm_4 213..>385 CDD:304433 47/226 (21%)
ADGRD2NP_001382354.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.