DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRE2

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_011526250.1 Gene:ADGRE2 / 30817 HGNCID:3337 Length:837 Species:Homo sapiens


Alignment Length:439 Identity:93/439 - (21%)
Similarity:166/439 - (37%) Gaps:109/439 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SEDELNKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFT-------- 161
            :.|..|...| |..|.|..||:.|  ::.|.|..:..:.||...........|...|        
Human   455 NNDTQNLSSP-VTFTFSHRSVIPR--QKVLCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTH 516

  Fly   162 LFENGSLLRHWDKVELSKREYCVQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILT 226
            |.....|:.|:|..|              :|.:.....:..||             :||:|::|.
Human   517 LSSFAVLMAHYDVQE--------------EDPVLTVITYMGLS-------------VSLLCLLLA 554

  Fly   227 ISVYLYVEKLRN----LHGKCFICYLASLFLGY--FFLVLNVWKYSSGFCVTAGFLGYFSVMAAF 285
            ...:|..:.::|    ||.:..:|    |||.:  |.:.::...:.....:.||.|.|. .:|..
Human   555 ALTFLLCKAIQNTSTSLHLQLSLC----LFLAHLLFLVAIDQTGHKVLCSIIAGTLHYL-YLATL 614

  Fly   286 FWLSVIGIHLRIKFSLASN-------CLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNE 343
            .|:.:..::|   |..|.|       .::|.:.:..|..    .:|:|.:..||:..:       
Human   615 TWMLLEALYL---FLTARNLTVVNYSSINRFMKKLMFPV----GYGVPAVTVAISAAS------- 665

  Fly   344 KLRPRV-GVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTN 407
              ||.: |....||:.. :...:..|.||:..:.:.|:::|:::   ::.:|..:..|..:..| 
Human   666 --RPHLYGTPSRCWLQP-EKGFIWGFLGPVCAIFSVNLVLFLVT---LWILKNRLSSLNSEVST- 723

  Fly   408 QQINDQQM--FAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYF---NWSQGTIIFVLF 467
              :.:.:|  |....:|||| |.:|...||       |....|.::|..|   |..||..||:::
Human   724 --LRNTRMLAFKATAQLFIL-GCTWCLGIL-------QVGPAARVMAYLFTIINSLQGVFIFLVY 778

  Fly   468 ILKPSILKLIIAGGRQNLPGSHHNSRSKAARYNST----HTACEGSIAD 512
            .|....::            ..:...||..|...|    ||....:.||
Human   779 CLLSQQVR------------EQYGKWSKGIRKLKTESEMHTLSSSAKAD 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 21/103 (20%)
7tm_4 213..>385 CDD:304433 39/185 (21%)
ADGRE2XP_011526250.1 EGF_CA 67..117 CDD:284955
EGF_CA 119..154 CDD:238011
EGF_CA 163..210 CDD:284955
EGF_CA 212..246 CDD:284955
GPS 479..529 CDD:197639 9/49 (18%)
7tm_4 533..774 CDD:304433 62/289 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.