DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgrf3

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_006239862.1 Gene:Adgrf3 / 298857 RGDID:1305868 Length:992 Species:Rattus norvegicus


Alignment Length:449 Identity:104/449 - (23%)
Similarity:159/449 - (35%) Gaps:134/449 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 AKPGCPRMYFLNHELPGNEFTLFE--------NGSLLRH---WDKVELSKR-----EYC------ 183
            |.||  .:..::....|.:||..|        ||:|  |   ||......|     |.|      
  Rat   601 ATPG--MILVISITADGQDFTQAEVIMDFEDMNGTL--HCVFWDHNAFQGRGGWSDEGCELQAAN 661

  Fly   184 -------VQHL-SFKDDSIRIAPHFC---PLSSEHSRTWKTVAIVISLICIILTISVYLYVEKLR 237
                   .:|| :|   ||.::.|..   ||....|:.....:|:..|:|:::...|:..|  :|
  Rat   662 ASAVQCVCRHLTAF---SILMSQHAVPEDPLLDLLSQVGVGASILALLVCLVIYRLVWRVV--VR 721

  Fly   238 N-----LHGKCF---ICYLA--SLFLGYFFLVLNVW---KYSSGFCVTAGFLGYFSVMAAFFWLS 289
            |     .|...|   ||.|.  :.|||      |.|   .|.|..|:...||.:|..:|.|||: 
  Rat   722 NKVAFFRHTALFNMVICLLVADTCFLG------NPWLPSGYHSLVCLATAFLCHFFYLATFFWM- 779

  Fly   290 VIGIHLRIKFSLASNCL---HRLLPENPFRAYNLYAWGIPLIMTAIT---YTADQVVKNEKLRPR 348
                 |.....||...|   |:|.........::..:..||....:|   |...:....|     
  Rat   780 -----LAQALVLAHQLLFVFHQLSKPLVLSMMSILGYLCPLGFAGVTLGLYLPQRKYLRE----- 834

  Fly   349 VGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQ 413
               || | :.:||...:..|..|:|.:::.|.::.|::.:.:.....:....|.|:|.       
  Rat   835 ---GK-C-LLSGDGVSLHAFSEPVLAIVSVNGLVLVIAVLKLLRPSLSEGPAVEKRQA------- 887

  Fly   414 QMFAIFLRLFIL---MGLSWSFEILSFLLTKQQAWARALMVADY----FNWSQGTIIFVLFILKP 471
             :..:...|.||   .||:|...:.:..        ...:|..|    .|..||..|||...|..
  Rat   888 -LVGVLKALLILTPIFGLTWGLGVTTLF--------EGSLVFHYIFVILNSLQGVFIFVFGCLTD 943

  Fly   472 SILKLIIAGGRQNLPGS------------------HHNSRSKAARYNSTHTACEGSIAD 512
               |.::...|:.|.||                  |...||:.|.|       |..:||
  Rat   944 ---KKVLEALRKWLRGSRSSNSAISMVTNESCTSEHSRERSELASY-------EEQMAD 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 22/89 (25%)
7tm_4 213..>385 CDD:304433 47/190 (25%)
Adgrf3XP_006239862.1 HRM 353..>395 CDD:295297
GPS 632..679 CDD:197639 13/51 (25%)
7tm_4 687..935 CDD:304433 65/287 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.