DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRD1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001317426.1 Gene:ADGRD1 / 283383 HGNCID:19893 Length:906 Species:Homo sapiens


Alignment Length:477 Identity:99/477 - (20%)
Similarity:159/477 - (33%) Gaps:149/477 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YLYEGLLIPAHLTAEYDYKLLADDSKEKVASHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSE 106
            :.|...:.|||               .|:|.     |.|.:.|:.|.......::.|.       
Human   464 HYYLNNIWPAH---------------TKIAE-----AMHHQDCLLFATSHLISLEVSP------- 501

  Fly   107 DELNKHDPFVNVTLSDGSVVRRHFKEDLI-VQSDLAKPGCPRMY----FL----------NHELP 156
                  .|.::..||...::..|.|..|. .|...|.....|::    ||          ||...
Human   502 ------PPTLSQNLSGSPLITVHLKHRLTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCA 560

  Fly   157 ---GN------EFTLFENGSLLRHWDKVELSK-REYCVQHLSFKDDSIRIAPHFCPLSSEHSRTW 211
               ||      ..|...|.::|.....:||:: .:..:..:|:..         |.||       
Human   561 LTRGNLTYSVCRCTHLTNFAILMQVVPLELARGHQVALSSISYVG---------CSLS------- 609

  Fly   212 KTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF--C 270
                 |:.|:..::|.:|...|..:||    :|.......|.:.     .|:|..::...|.  |
Human   610 -----VLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQ-----VLLLISFRLEPGTTPC 664

  Fly   271 VTAGFLGYFSVMAAFFWLSVIGIHLR---IKFSLASNCLHRLLPENPFRAYNLYAWGIPLI--MT 330
            .....|.::..::||.|:.|.|:||.   ||...:.:..||.        |....||.||:  :.
Human   665 QVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRY--------YYGMGWGFPLLICII 721

  Fly   331 AITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNI-----IMFVLSAIYI 390
            ::::..|.          .|...|||:......:.. |..|.|.:|..||     :..|:|.|..
Human   722 SLSFAMDS----------YGTSNNCWLSLASGAIWA-FVAPALFVIVVNIGILIAVTRVISQISA 775

  Fly   391 YNIKKNVKGLVHKQQTNQQINDQQMFAIFLR----LFILMGLSWSFEILSFLLTKQQAWARALMV 451
            .|.|      :|        .|...|.:..:    |..::|.||.|.:|        |.....:|
Human   776 DNYK------IH--------GDPSAFKLTAKAVAVLLPILGTSWVFGVL--------AVNGCAVV 818

  Fly   452 ADY----FNWSQGTIIFVLFIL 469
            ..|    .|..||..||:...|
Human   819 FQYMFATLNSLQGLFIFLFHCL 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 32/183 (17%)
7tm_4 213..>385 CDD:304433 41/187 (22%)
ADGRD1NP_001317426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.