DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgrd1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001074811.1 Gene:Adgrd1 / 243277 MGIID:3041203 Length:903 Species:Mus musculus


Alignment Length:394 Identity:89/394 - (22%)
Similarity:144/394 - (36%) Gaps:94/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PFVNVTLSDGSVVRRHFKEDLIVQ--SDLAKPGCPRMY----FLNHELPGNEFTLFENGSLLRHW 172
            |.::..||...::..|.:..|..:  || |.....|::    |||          |.:|..:  |
Mouse   500 PTLSQNLSGSPLITVHLRHKLTQKQYSD-ATNESNRLFLYCAFLN----------FSSGEGV--W 551

  Fly   173 DKVELSKRE----YCVQHLSFKDDSIRIAPHFCPLSSEHSR-----TWKTVAIVISLICI---IL 225
            .....:..|    |.|.|.:.. .:..|.....||...|..     :...|...:|::|:   ::
Mouse   552 SSQGCALTEGNLTYSVCHCTHL-TNFAILMQVVPLKLTHGHQVALSSISYVGCSLSVLCLAATLV 615

  Fly   226 TISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF--CVTAGFLGYFSVMAA 284
            |.:|...|..:||    :|.......|.:.     .|:|..:....|.  |.....|.::..:.|
Mouse   616 TFAVLSSVSTIRNQRYHIHANLSFAVLVAQ-----VLLLISFSMEPGTVPCQVLAVLLHYFFLTA 675

  Fly   285 FFWLSVIGIHLR---IKFSLASNCLHRLLPENPFRAYNLY----AWGIPLIMTAITYTADQVVKN 342
            |.|:.|.|:||.   ||...:.:..|            ||    .||.||::..|:.::..    
Mouse   676 FAWMLVEGLHLYSMVIKVFGSEDSKH------------LYYYGIGWGCPLLICIISISSSM---- 724

  Fly   343 EKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTN 407
                ...|...:||:..|...:.. |.||.||:|..||::.|.....|.:|..: ...:|     
Mouse   725 ----DSYGTSDSCWLALGSGAIWA-FVGPALLVIVVNIVILVAVTRVISHISTD-SYKIH----- 778

  Fly   408 QQINDQQMFAIFLR----LFILMGLSWSFEILSFLLTKQQAWARALMVADYF---NWSQGTIIFV 465
               .|...|.:..:    |..::|.||.|.:|:       ...|||:....|   |..||..||:
Mouse   779 ---GDPSAFKLTAKAVAVLLPILGTSWVFGVLA-------VSDRALVFQYMFAILNSLQGLFIFL 833

  Fly   466 LFIL 469
            ...|
Mouse   834 FHCL 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 20/96 (21%)
7tm_4 213..>385 CDD:304433 44/187 (24%)
Adgrd1NP_001074811.1 Laminin_G_3 <173..273 CDD:290121
GPS 539..579 CDD:280071 10/52 (19%)
Stachel. /evidence=ECO:0000250|UniProtKB:Q6QNK2 575..583 1/7 (14%)
7tm_4 595..831 CDD:304433 63/277 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 862..903
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.