DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgrg4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001349814.1 Gene:Adgrg4 / 236798 MGIID:2685213 Length:3025 Species:Mus musculus


Alignment Length:403 Identity:93/403 - (23%)
Similarity:156/403 - (38%) Gaps:110/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWD- 173
            |..||.:        ::.:|.:.|                 .|::.....|..|:..:.|..|: 
Mouse  2564 NLADPVI--------IILKHIQGD-----------------WNYDQVYCAFWDFDTNNGLGGWNP 2603

  Fly   174 ---KVELSKREYCV---QHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTIS---- 228
               |::.|...|.:   .||:          ||..| .:.||:  ||..|...|.:|:|.:    
Mouse  2604 SGCKLKESNINYTICQCNHLT----------HFGVL-MDLSRS--TVDAVNERILVIITYTGCGI 2655

  Fly   229 ----------VYLYVEKLRNLHGKCFICYL--ASLFLGYFFLVLNVWKYS---SGFCVTAGFLGY 278
                      .|:...|||..:....:..|  |.|.|...||| |.|..|   .|.|:||....:
Mouse  2656 SSIFLGIAMVTYIAFHKLRKDYPSKILINLCTALLMLNLAFLV-NSWLTSFQKVGLCITAAVALH 2719

  Fly   279 FSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNE 343
            :.::.:..|:.:..:|:  .|:|. ...:..:| |....:.|..||||.|..||..:    |:.:
Mouse  2720 YFLLVSLTWMGLEAVHM--YFALV-KVFNTYIP-NYILKFCLAGWGIPAITVAIILS----VRKD 2776

  Fly   344 ---KLRPRVGVGKNCWI---YTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVH 402
               .|.|....   |||   :...::|:.||    .|:...|:.||....:.:.::|.      .
Mouse  2777 LYGTLSPTTPF---CWIKDDHIFYISVVAYF----CLIFLMNLSMFCTVLVQLTSVKS------Q 2828

  Fly   403 KQQTNQQ--INDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYF----NWSQGT 461
            .|:|.::  :||.:.   .:.|..|:||:|.|...        ||....:...|.    |..||.
Mouse  2829 SQKTRKKMILNDLKG---TISLTFLLGLTWGFAFF--------AWGPVRIFFLYLFAICNTLQGF 2882

  Fly   462 IIFVLF-ILKPSI 473
            :|||.: ::|.|:
Mouse  2883 LIFVFYCVMKESV 2895

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 16/97 (16%)
7tm_4 213..>385 CDD:304433 51/196 (26%)
Adgrg4NP_001349814.1 LamG <54..162 CDD:328935
DnaJ <276..746 CDD:333066
GPS 2587..2629 CDD:307782 11/51 (22%)
7tmB2_GPR112 2642..2903 CDD:320663 70/287 (24%)
TM helix 1 2644..2669 CDD:320663 4/24 (17%)
TM helix 2 2679..2701 CDD:320663 8/22 (36%)
TM helix 3 2712..2739 CDD:320663 4/28 (14%)
TM helix 4 2754..2770 CDD:320663 7/15 (47%)
TM helix 5 2793..2816 CDD:320663 6/26 (23%)
TM helix 6 2838..2863 CDD:320663 9/35 (26%)
TM helix 7 2867..2892 CDD:320663 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.