DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRL1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_016881964.1 Gene:ADGRL1 / 22859 HGNCID:20973 Length:1506 Species:Homo sapiens


Alignment Length:392 Identity:94/392 - (23%)
Similarity:157/392 - (40%) Gaps:86/392 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 NHELPGNEFTLFENGSLLRHWDK-----VELSK-REYCV-QHLSFKDDSIRIAPHFCPLSSEHS- 208
            ||......|..:...|:|.:|..     ||.:| ...|. .||:          :|..|.:... 
Human   804 NHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLT----------NFAVLMAHREI 858

  Fly   209 ------------RTWKTVAIVISLICIILTISVYLYVEKL---RNLHGK--CFICYLASLFLGYF 256
                        .||  |.|||||:|:.:.||.:.::..|   ||...|  |...:||.|.   |
Human   859 YQGRINELLLSVITW--VGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCINLFLAELL---F 918

  Fly   257 FLVLNVWKYSSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPE------NPF 315
            .:.::..:|.....:.||.|.|| .:|||.||.:.|:|           |:.||.|      :..
Human   919 LVGIDKTQYEIACPIFAGLLHYF-FLAAFSWLCLEGVH-----------LYLLLVEVFESEYSRT 971

  Fly   316 RAYNLYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNI 380
            :.|.|..:..|.::..|....|.        ...|..|.||:.. |...:..|.||:..:|..|:
Human   972 KYYYLGGYCFPALVVGIAAAIDY--------RSYGTEKACWLRV-DNYFIWSFIGPVSFVIVVNL 1027

  Fly   381 IMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAI-FLRLFILMGLSWSFEILSFLLTKQQA 444
            :..:::      :.|.::.....:..:.::::.:.:|: .:.|..|:||:|:|.:|  .:.|:..
Human  1028 VFLMVT------LHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLL--FINKESV 1084

  Fly   445 WARALMVADYFNWSQGTIIFVLF-ILKPSILKLIIAGGRQNL------PGSHHNS-RSKAARYNS 501
            ....|...  ||..||..|||.. .|:..:.|......|.:.      ||..|.| ::.|.|.|:
Human  1085 VMAYLFTT--FNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNT 1147

  Fly   502 TH 503
            .:
Human  1148 RY 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 12/55 (22%)
7tm_4 213..>385 CDD:304433 50/182 (27%)
ADGRL1XP_016881964.1 Gal_Lectin 48..128 CDD:396628
OLF 143..399 CDD:413369
PHA03247 <399..503 CDD:223021
HormR 484..547 CDD:214468
GAIN 557..782 CDD:406802
GPS 806..858 CDD:197639 12/61 (20%)
7tmB2_Latrophilin-1 865..1122 CDD:320673 72/292 (25%)
TM helix 1 868..892 CDD:320673 11/25 (44%)
TM helix 2 901..922 CDD:320673 7/23 (30%)
TM helix 3 932..954 CDD:320673 10/22 (45%)
TM helix 4 973..989 CDD:320673 3/15 (20%)
TM helix 5 1008..1031 CDD:320673 6/22 (27%)
TM helix 6 1058..1080 CDD:320673 8/23 (35%)
TM helix 7 1084..1109 CDD:320673 8/26 (31%)
Latrophilin 1121..1506 CDD:396778 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.