DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRF4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001334784.1 Gene:ADGRF4 / 221393 HGNCID:19011 Length:695 Species:Homo sapiens


Alignment Length:341 Identity:73/341 - (21%)
Similarity:129/341 - (37%) Gaps:89/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RHWDKVELSKREYCVQHLSFKDD------SIRIAPHFCPLSSEHSRTWK----------TVAIVI 218
            |.||:      :.|...|..:::      ...:...|..|.|..|.|.|          :|:|:.
Human   357 RRWDE------KACQMMLDIRNEVKCRCNYTSVVMSFSILMSSKSMTDKVLDYITCIGLSVSILS 415

  Fly   219 SLICIILTISVY--LYVEKLRNLHGKCFICYLASLFLGYFFLVLNVW----------KYSSGFCV 271
            .::|:|:..:|:  :.|.::..:...|.:....||      |..|||          ......||
Human   416 LVLCLIIEATVWSRVVVTEISYMRHVCIVNIAVSL------LTANVWFIIGSHFNIKAQDYNMCV 474

  Fly   272 TAGFLGYFSVMAAFFW------LSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMT 330
            ...|..:|..::.|||      |.:.||.:         ...|::............:|.|||: 
Human   475 AVTFFSHFFYLSLFFWMLFKALLIIYGILV---------IFRRMMKSRMMVIGFAIGYGCPLII- 529

  Fly   331 AITYTADQVVKNEK--LRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNI 393
            |:|..|  :.:.||  :||..     ||:...:...::.|..|..:::|.|:|:.::.|      
Human   530 AVTTVA--ITEPEKGYMRPEA-----CWLNWDNTKALLAFAIPAFVIVAVNLIVVLVVA------ 581

  Fly   394 KKNVKGLVHKQQTNQQINDQQMFAIFLR-------LFILMGLSWSFEILSFL----LTKQQAWAR 447
                   |:.|:.:...:..|...|.:|       |..|:||:|.|.|.:.:    ||....:|.
Human   582 -------VNTQRPSIGSSKSQDVVIIMRISKNVAILTPLLGLTWGFGIATLIEGTSLTFHIIFAL 639

  Fly   448 ALMVADYFNWSQGTII 463
            ......:|....|||:
Human   640 LNAFQGFFILLFGTIM 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 5/36 (14%)
7tm_4 213..>385 CDD:304433 42/191 (22%)
ADGRF4NP_001334784.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.