DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRG5

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001291305.1 Gene:ADGRG5 / 221188 HGNCID:19010 Length:528 Species:Homo sapiens


Alignment Length:535 Identity:90/535 - (16%)
Similarity:173/535 - (32%) Gaps:173/535 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NAEIPG------------------CDF----FDTVDISKAPRFSNGSYL--YEGLLIPAHLTAEY 57
            |...||                  |||    ..:..:.:.|: :.|.:.  ...:..||.||.: 
Human    58 NTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQ-AGGQHARGQHAMQFPAELTRD- 120

  Fly    58 DYKLLADDSKEKVASHVRGCACHLRP------CIRFCCPQYQKMQKSKCYGDMSEDELNK---HD 113
                                ||..||      ||.|....:.|            ||.|.   ::
Human   121 --------------------ACKTRPRELRLICIYFSNTHFFK------------DENNSSLLNN 153

  Fly   114 PFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFT--LFENGSLLRHWD--- 173
            ..:...||.|.|  .:.::.:.:.           ::.|..|.|...|  .::.|:..:.|.   
Human   154 YVLGAQLSHGHV--NNLRDPVNIS-----------FWHNQSLEGYTLTCVFWKEGARKQPWGGWS 205

  Fly   174 ----KVELSKREYCV---QHLSFKDDSIRIAPHFCPLSSEHSRTW-KTVAIVISLICIILTISVY 230
                :.|.......:   .||::....::::|...|.......|: ..|...||::..::|:.::
Human   206 PEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLH 270

  Fly   231 LYVEKL--------RNLHGKCFICYLASLFLGYFFLVLNVWKYS---SGFCVTAGFLGYFSVMAA 284
            .:..|.        .|||.       :.|.|...||:...:..|   ...|.......::::::.
Human   271 FHFRKQSDSLTRIHMNLHA-------SVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSC 328

  Fly   285 FFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLY-----------AWGIPLIMTAITYTADQ 338
            ..|:::.|.:|.:...               |.||:|           .||.|.::..::.:...
Human   329 LTWMAIEGFNLYLLLG---------------RVYNIYIRRYVFKLGVLGWGAPALLVLLSLSVKS 378

  Fly   339 VVKNEKLRPRVGVGKN---------CWIYTGDM-TVMIYFYGPMLLLIAFNIIMFVLSAIYIYNI 393
            .|......|.....:|         ||:.:..: :|::..||.:..|  ||:::...:...:..:
Human   379 SVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYGGLTSL--FNLVVLAWALWTLRRL 441

  Fly   394 KKNVKG----LVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSF--LLTKQQAWARALMVA 452
            ::....    ..|...|            .|.|.:|:|.:|:....||  .|..|      |.:.
Human   442 RERADAPSVRACHDTVT------------VLGLTVLLGTTWALAFFSFGVFLLPQ------LFLF 488

  Fly   453 DYFNWSQGTIIFVLF 467
            ...|...|..:|:.|
Human   489 TILNSLYGFFLFLWF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 34/204 (17%)
7tm_4 213..>385 CDD:304433 35/203 (17%)
ADGRG5NP_001291305.1 GPS 187..232 CDD:307782 6/44 (14%)
7tmB2_GPR114 245..518 CDD:320559 52/301 (17%)
TM helix 1 247..272 CDD:320559 5/24 (21%)
TM helix 2 281..303 CDD:320559 7/28 (25%)
TM helix 3 315..342 CDD:320559 3/26 (12%)
TM helix 4 355..375 CDD:320559 3/19 (16%)
TM helix 5 409..438 CDD:320559 6/30 (20%)
TM helix 6 451..478 CDD:320559 8/38 (21%)
TM helix 7 482..507 CDD:320559 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.