DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRE1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_011526096.1 Gene:ADGRE1 / 2015 HGNCID:3336 Length:978 Species:Homo sapiens


Alignment Length:484 Identity:106/484 - (21%)
Similarity:172/484 - (35%) Gaps:184/484 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YGDMSEDELNKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRM----------------- 148
            |.|:....:||.....||||            ||:.:.|..|.||..:                 
Human   524 YLDIESKVINKECSEENVTL------------DLVAKGDKMKIGCSTIEESESTETTGVAFVSFV 576

  Fly   149 ---------YFLNHELP--GNEFTLFEN----GSLLRHWDKVELS----------------KREY 182
                     :|.:|:.|  .:|..|..|    |.::....|...|                :|..
Human   577 GMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPI 641

  Fly   183 CV---------QHLSF--------------------------------KDDSIRIAPHFCPLSSE 206
            ||         :..||                                .|.|:.|..|       
Human   642 CVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISH------- 699

  Fly   207 HSRTWKTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYL--ASLFLGYFFLVLNVWKY 265
                   |.|:|||:|::|.|:.:|....:||    ||....:|.|  .:|||.......|    
Human   700 -------VGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTLFLAGIHKTDN---- 753

  Fly   266 SSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNL-------YAW 323
            ..|..:.||||.|. .:|.|||:.|..:   |.|.:..|    |...|.|.:.|:       :.:
Human   754 KMGCAIIAGFLHYL-FLACFFWMLVEAV---ILFLMVRN----LKVVNYFSSRNIKMLHICAFGY 810

  Fly   324 GIPLIMTAITYTADQVVKNEKLRPR-VGVGKNCWIYTGDMTVMIY-FYGPMLLLIAFNIIMFVLS 386
            |:|:::         ||.:..::|: .|:...||:.|  .|..|: |.||:..:|..|.::...:
Human   811 GLPMLV---------VVISASVQPQGYGMHNRCWLNT--ETGFIWSFLGPVCTVIVINSLLLTWT 864

  Fly   387 AIYIYNIKKNVKGLVHKQQTNQQINDQQM--FAIFLRLFILMGLSW---SFEI------LSFLLT 440
               ::.:::.:..:..:..|   :.|.::  |..|.:|||| |.||   .|:|      :::|.|
Human   865 ---LWILRQRLSSVNAEVST---LKDTRLLTFKAFAQLFIL-GCSWVLGIFQIGPVAGVMAYLFT 922

  Fly   441 KQQAWARALMVADYFNWSQGTIIFVLFIL 469
                         ..|..||..||::..|
Human   923 -------------IINSLQGAFIFLIHCL 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 32/188 (17%)
7tm_4 213..>385 CDD:304433 53/186 (28%)
ADGRE1XP_011526096.1 EGF_CA 33..62 CDD:238011
EGF_CA 80..114 CDD:214542
EGF_CA 132..171 CDD:214542
EGF_CA 172..206 CDD:214542
EGF_CA 224..260 CDD:214542
EGF_CA 264..297 CDD:214542
EGF_CA 313..>342 CDD:214542
EGF_CA 360..400 CDD:284955
GPS 638..687 CDD:197639 5/48 (10%)
7tm_2 691..932 CDD:278432 75/297 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.