DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and CG43968

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster


Alignment Length:373 Identity:71/373 - (19%)
Similarity:127/373 - (34%) Gaps:113/373 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMY--FLNHELPGNEFTL--FENGSLLRHWDKV 175
            ::::|.:..|....:.||...|.:   .|..|:.:  |:..::..:.|.|  .:|.:.|      
  Fly   510 WIHITATLKSTASTYHKEIAFVDN---TPRIPKDFVAFMKVKITLSNFFLNFIKNSTYL------ 565

  Fly   176 ELSKREYCVQHLSFKDDSIRI----------------------APH--FCPLSSEHSRTWKTVAI 216
             |...:||...|||.:|.:.:                      .|:  .|.....|...||  .:
  Fly   566 -LRSTDYCFSELSFSNDGMHLWWTTTRIGEIAMTKKLCIQKDGMPYTRLCLGDFVHGAYWK--KL 627

  Fly   217 VISLICIILTISVYLYVEKLRN----LH----GKCF-------ICYL-------------ASLFL 253
            ...::|           |..:|    ||    .|.|       :.||             |.:||
  Fly   628 TQPVVC-----------ESPKNNTKVLHDLQVAKMFKSPPEKVLKYLKDIIANSKNSIVPADIFL 681

  Fly   254 GY--FFLVLNVWKYSSGFCVTAGFLGYF--SVMAAF-FWLSVIGIHLR-IKFSLASNCLHRLLPE 312
            .|  |..|..:...:|.|..|...|..:  ::...| .:..:||:..: ||.|...|        
  Fly   682 IYKIFQSVHEIHSSNSEFQQTTKDLTNWKNAIYEIFDIYNVLIGLDSKVIKMSAELN-------- 738

  Fly   313 NPFRAYNLYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIA 377
                |.|::.....::...::.......:.:.....:....:..|...|:.|.:|.   ...::.
  Fly   739 ----ATNMFLKSFEMLFDTLSLNNLSFTQIDNGEEHLNDFNSETIDYDDIGVSVYV---SKYILY 796

  Fly   378 FNIIMFVLS----AIYIYNIKKN----VKGLVHKQ-----QTNQQIND 412
            |:||..:.:    |::..|.|||    :||....:     |.|..|||
  Fly   797 FSIIPSIANVSGIALFANNNKKNTPTKLKGAFKNEHYRFLQVNHNIND 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 20/113 (18%)
7tm_4 213..>385 CDD:304433 35/205 (17%)
CG43968NP_001262238.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.