DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRG4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_722576.3 Gene:ADGRG4 / 139378 HGNCID:18992 Length:3080 Species:Homo sapiens


Alignment Length:391 Identity:100/391 - (25%)
Similarity:160/391 - (40%) Gaps:88/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNE--------FTLFENGSLLRHWD----KVEL 177
            ||.....:|:.:| :||.   |.:..|.| :.||:        |..|||.:.|..|:    ||:.
Human  2649 VVSASISDDMFIQ-NLAD---PVVITLQH-IGGNQNYGQVHCAFWDFENNNGLGGWNSSGCKVKE 2708

  Fly   178 SKREYCV---QHLSFKDDSIRIAPHFCPL-----SSEHSRTWKTVAIV------ISLICIILTIS 228
            :...|.:   .||:          ||..|     |:..|...:.:|::      ||.|.:.:.:.
Human  2709 TNVNYTICQCDHLT----------HFGVLMDLSRSTVDSVNEQILALITYTGCGISSIFLGVAVV 2763

  Fly   229 VYLYVEKLRNLHGKCFICYL--ASLFLGYFFLVLNVWKYS---SGFCVTAGFLGYFSVMAAFFWL 288
            .|:...|||..:....:..|  |.|.|...||: |.|..|   .|.|:||....::.::.:|.|:
Human  2764 TYIAFHKLRKDYPAKILINLCTALLMLNLVFLI-NSWLSSFQKVGVCITAAVALHYFLLVSFTWM 2827

  Fly   289 SVIGIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNE---KLRPRVG 350
            .:..:|:.:......|.   .:| |....:.|..||||.||.|||.:    ||.:   .|.|...
Human  2828 GLEAVHMYLALVKVFNI---YIP-NYILKFCLVGWGIPAIMVAITVS----VKKDLYGTLSPTTP 2884

  Fly   351 VGKNCWIYTGD---MTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQIND 412
            .   |||....   ::|:.||    .|:...|:.||....:.:    .:||..:.|.:....::|
Human  2885 F---CWIKDDSIFYISVVAYF----CLIFLMNLSMFCTVLVQL----NSVKSQIQKTRRKMILHD 2938

  Fly   413 QQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARA----LMVADYFNWSQGTIIFVLF-ILKPS 472
            .:.   .:.|..|:||:|.|...        ||...    |.:...||..||..|||.. ::|.|
Human  2939 LKG---TMSLTFLLGLTWGFAFF--------AWGPMRNFFLYLFAIFNTLQGFFIFVFHCVMKES 2992

  Fly   473 I 473
            :
Human  2993 V 2993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 23/90 (26%)
7tm_4 213..>385 CDD:304433 51/188 (27%)
ADGRG4NP_722576.3 LamG 28..210 CDD:304605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 946..965
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1274..1348
CytochromB561_N <1668..>1909 CDD:286826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2109..2141
GPS 2684..2727 CDD:280071 13/52 (25%)
7tm_2 2743..2982 CDD:278432 68/269 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3051..3080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.