DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgre1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001342651.1 Gene:Adgre1 / 13733 MGIID:106912 Length:931 Species:Mus musculus


Alignment Length:562 Identity:113/562 - (20%)
Similarity:193/562 - (34%) Gaps:199/562 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIAVLFLLMPKSNAEIPGCDFFDTVDISKAPRFSNGSYLYEGLLIPA-----HLTAEY---DY 59
            :|..|..:..:.|......|....:||:          |.:...||||:     .:..||   :.
Mouse   434 VLEQATTWFELSKEETSTLGTILLETVE----------STMLAALLIPSGNASQMIQTEYLDIES 488

  Fly    60 KLLADDSKEKVASHV--RGCACHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSD 122
            |::.::.||..:.::  ||                              |::|.....:..::|.
Mouse   489 KVINEECKENESINLAARG------------------------------DKMNVGCFIIKESVST 523

  Fly   123 GSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKRE------ 181
            |:                  ||...:.|.:.|...|| ..||:|...|   |:.::.|.      
Mouse   524 GA------------------PGVAFVSFAHMESVLNE-RFFEDGQSFR---KLRMNSRVVGGTVT 566

  Fly   182 ------------YCVQHLSFKDDSI--------------RIAPHFCPLSSEHSRTWKT------- 213
                        |.:||:..|..|.              |..|..|.: .|.|.|...       
Mouse   567 GEKKEDFSKPIIYTLQHIQPKQKSERPICVSWNTDVEDGRWTPSGCEI-VEASETHTVCSCNRMA 630

  Fly   214 ----------------------VAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLF 252
                                  |..||||:|:.|.|:.:|....::|    :|....:|    ||
Mouse   631 NLAIIMASGELTMEFSLYIISHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHLCVC----LF 691

  Fly   253 LGYFFLVLNVWK--YSSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPF 315
            |.....:..:.|  ..:...:.||||.|. .:|.|||:.|..:.|   |.:..|    |...|.|
Mouse   692 LAKILFLTGIDKTDNQTACAIIAGFLHYL-FLACFFWMLVEAVML---FLMVRN----LKVVNYF 748

  Fly   316 RAYNL-------YAWGIPLIMTAITYTADQVVKNEKLRPR-VGVGKNCWIYTGDMTVMIY-FYGP 371
            .:.|:       :.:|:|:::         |:.:..::|| .|:...||:.|  .|..|: |.||
Mouse   749 SSRNIKMLHLCAFGYGLPVLV---------VIISASVQPRGYGMHNRCWLNT--ETGFIWSFLGP 802

  Fly   372 MLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSF---- 432
            :.::|..|.::...:...:.....:|...|.|.:..:.:.    |....::||| |.||..    
Mouse   803 VCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRLLT----FKAIAQIFIL-GCSWVLGIFQ 862

  Fly   433 -----EILSFLLTKQQAWARALMVADYFNWSQGTIIFVLFIL 469
                 .|:::|.|             ..|..||..||::..|
Mouse   863 IGPLASIMAYLFT-------------IINSLQGAFIFLIHCL 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 37/219 (17%)
7tm_4 213..>385 CDD:304433 49/215 (23%)
Adgre1NP_001342651.1 EGF_CA 33..63 CDD:238011
EGF_CA 81..115 CDD:214542
EGF_CA 133..172 CDD:214542
EGF_CA 173..>203 CDD:214542
EGF_CA 222..258 CDD:238011
EGF_CA 272..>301 CDD:214542
EGF_CA 319..352 CDD:214542
Cell attachment site. /evidence=ECO:0000255 506..508 2/31 (6%)
GPS 591..640 CDD:197639 6/49 (12%)
7tmB2_EMR 644..906 CDD:320555 68/289 (24%)
TM helix 1 646..671 CDD:320555 8/24 (33%)
TM helix 2 680..702 CDD:320555 5/25 (20%)
TM helix 3 711..738 CDD:320555 12/30 (40%)
TM helix 4 755..775 CDD:320555 3/28 (11%)
TM helix 5 792..815 CDD:320555 7/22 (32%)
TM helix 6 839..864 CDD:320555 7/29 (24%)
TM helix 7 868..893 CDD:320555 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.