DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and LOC110439896

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_021333224.1 Gene:LOC110439896 / 110439896 -ID:- Length:101 Species:Danio rerio


Alignment Length:111 Identity:28/111 - (25%)
Similarity:46/111 - (41%) Gaps:28/111 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 MLLLIAFNIIMFVLSAIYIYNIK----KNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSF 432
            |:|.|  |||:.:.|::...|::    |..|.:|.|.               |..|:::|..|  
Zfish     1 MILFI--NIIITLNSSLKNLNVEVSQMKQTKIMVFKT---------------LGQFVVLGCPW-- 46

  Fly   433 EILSFLLTKQQAWARALMVADYFNWSQGTIIFVLF-ILKPSILKLI 477
             ||.|............:|   .|..|||.||::: :|...:..|:
Zfish    47 -ILGFFTNVNMVIYILFLV---LNSQQGTFIFLIYCVLNNEVRHLL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 6/12 (50%)
LOC110439896XP_021333224.1 7tm_GPCRs <2..85 CDD:333717 26/105 (25%)
TM helix 6 29..52 CDD:320095 10/40 (25%)
TM helix 7 56..81 CDD:320095 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.