DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and adgrf3a

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_021322955.1 Gene:adgrf3a / 101886922 ZFINID:ZDB-GENE-131121-607 Length:949 Species:Danio rerio


Alignment Length:542 Identity:106/542 - (19%)
Similarity:197/542 - (36%) Gaps:168/542 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNAEIPGCDFFDTVDISK----APRFSNGSYLYEGL-----LIPAHLTAEYDYKLLADDSKEKVA 71
            |||::..|:.....||.|    :.|.|:.|.:..|.     ::|         |...:||...: 
Zfish   517 SNAQMALCNHTSPADICKTFNASVRNSDNSVVVFGFRNLYQILP---------KAEGNDSNTTI- 571

  Fly    72 SHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVRR-------- 128
                                            :|...:|.::...::||...|..:|        
Zfish   572 --------------------------------LSVTPVNANNTNRSITLEFDSAKQRLPNHMIYC 604

  Fly   129 -HFKEDLIVQSDLAKPGC-------PRMYFLNHELPGNEFTLF--ENGSLLRHWDKVELSKREYC 183
             ::.|:|   ::.:..||       |.:...:|   .:.||:.  :|...|.:.|::        
Zfish   605 VYWDENL---NEWSSDGCRWAGVDNPTLCICDH---NSAFTILMSKNAETLPYMDEL-------- 655

  Fly   184 VQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAI-VISLI-CIILTISVYLYVEK--LRNL-HGKC 243
                                      |:..:.| ::||: |:|:.:.|:..|.|  :.|. |...
Zfish   656 --------------------------TYAGLGISILSLLACLIIKVLVWDAVVKSPISNFRHVAL 694

  Fly   244 FICYLASLFLGYFFLVLNVWKYSS---GFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNC 305
            |...|..|.....||..:  |..|   .:|.....:.:|..:|.|||:      |.:.|.|    
Zfish   695 FNISLCLLLAHCMFLTTS--KPESIPPNWCSILTLIKHFFFLAVFFWM------LCLSFVL---- 747

  Fly   306 LHRL------LPENPFRAYNL-YAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWI-YTGDM 362
            ||::      |.:..|...:: ..:..|:|..|:||    :..|............||: |.|.:
Zfish   748 LHQMIYVFDRLRKKVFLGLSITVGYACPIIAVAVTY----ISFNNGAEGEYYSKSTCWLTYKGTL 808

  Fly   363 TVMIYFYGPMLLLIAFNIIMFV-LSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILM 426
            ...|:.:     :|....|:|| |..:.:..:|.....:...:..:::...:.|....:.|..::
Zfish   809 KGSIFAF-----IIPIGAIVFVNLFTLAVVIMKIATPSISEAKARDEKDVAKSMIKTIVFLSPVL 868

  Fly   427 GLSW--SFEILSFLLTKQQAWARALMVADY--FNWSQGTIIFVLFI-------LKPSILKLIIAG 480
            ||||  .|.:|...|| .:.|| ||:...:  ||..||  :|:|..       ::.::||     
Zfish   869 GLSWVLGFFVLGLDLT-VKPWA-ALVNYSFTIFNSLQG--LFILLTNCVGEKKVRDALLK----- 924

  Fly   481 GRQNLPGSHHNSRSKAARYNST 502
             |..:..|.|:....:::..|:
Zfish   925 -RFKIKQSVHSKTESSSKAQSS 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 29/204 (14%)
7tm_4 213..>385 CDD:304433 45/188 (24%)
adgrf3aXP_021322955.1 GPS 604..641 CDD:307782 8/42 (19%)
7tm_GPCRs 649..926 CDD:333717 72/341 (21%)
TM helix 1 652..676 CDD:320095 7/57 (12%)
TM helix 2 691..712 CDD:320095 6/20 (30%)
TM helix 3 723..745 CDD:320095 6/27 (22%)
TM helix 4 766..782 CDD:320095 3/15 (20%)
TM helix 5 805..831 CDD:320095 7/30 (23%)
TM helix 6 855..881 CDD:320095 8/25 (32%)
TM helix 7 890..915 CDD:320095 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.