DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRG2

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001073327.1 Gene:ADGRG2 / 10149 HGNCID:4516 Length:1017 Species:Homo sapiens


Alignment Length:287 Identity:72/287 - (25%)
Similarity:119/287 - (41%) Gaps:65/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ISLICIILTISVYLYVEKL-RNLHGKCFICYLASLFLGYFFLVLNVW--KYS-SGFCVT-AGFLG 277
            :|.|.:.:|:..|:..||: |:...|..|...|:|.|.....:|:.|  .|. .|.|:: |.||.
Human   638 LSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVFLH 702

  Fly   278 YFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNL----YAWGIPLIMTAITYTADQ 338
            || ::.:|.|:.:...|:.:......|..        .|.|.|    ..||:|.::..|..|   
Human   703 YF-LLVSFTWMGLEAFHMYLALVKVFNTY--------IRKYILKFCIVGWGVPAVVVTIILT--- 755

  Fly   339 VVKNEKLRP-RVGVGKN-----------CWIYTGD---MTVMIYFYGPMLLLIAFNIIMFVLSAI 388
                  :.| ..|:|..           |||....   :||:.||    .::...|:.||::..:
Human   756 ------ISPDNYGLGSYGKFPNGSPDDFCWINNNAVFYITVVGYF----CVIFLLNVSMFIVVLV 810

  Fly   389 YIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVAD 453
            .:..|||. |.|..:::|:  |.|.:..|   .|..|:|::|.|...        ||....:...
Human   811 QLCRIKKK-KQLGAQRKTS--IQDLRSIA---GLTFLLGITWGFAFF--------AWGPVNVTFM 861

  Fly   454 Y----FNWSQGTIIFVLF-ILKPSILK 475
            |    ||..||..||:.: :.|.::.|
Human   862 YLFAIFNTLQGFFIFIFYCVAKENVRK 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 47/190 (25%)
ADGRG2NP_001073327.1 GPS 569..612 CDD:280071
7tm_4 625..875 CDD:304433 68/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.