DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and adgrf11

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:357 Identity:76/357 - (21%)
Similarity:130/357 - (36%) Gaps:87/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWD------K 174
            ||.||.:.|.|....::.|         |.|:..|.|..              |..||      |
Zfish   297 VNQTLQNISFVFDTTEQSL---------GNPQCVFWNFH--------------LSTWDSTGCEVK 338

  Fly   175 VELSKRE-------YCVQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAI-VISL-ICIILTISVY 230
            ..||:.|       .|....||   |:.::|.|....:....|:..:.| |:|| |.:|:...|:
Zfish   339 PNLSEEEKIDKITCECNHTTSF---SLLMSPFFIDDKALDYITYTGLGISVLSLVISLIIGAIVW 400

  Fly   231 LYVEKLRN--LHGKCFICYLASLFLGYFFLVLNVWKYSSGF------CVTAGFLGYFSVMAAFFW 287
            ..|.|..:  |...|.:....||.:.....::.......|.      |....|..:...:|.|||
Zfish   401 TTVTKSNSAYLRHVCLVNTNVSLLVADVCFIIGASIVQPGQLAPVGPCTAVAFSMHLFFLAFFFW 465

  Fly   288 LSVIGIHLRIKFSLASNCLHR--LLPENPFRAYNLYAWGIPLIMTAITY--TADQVVKNEKLRPR 348
            :.:..:.|....::..:.:.|  ::....|..|     |.||::..|||  ||.:          
Zfish   466 MLISAMLLLYMTTMVYSQMSRAKMMAIAFFLGY-----GAPLLIVVITYGLTARE---------- 515

  Fly   349 VGVGKN------CWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTN 407
               ||.      ||:...:...:..|........|.|:::.:   :.:|      |.|:.::|.|
Zfish   516 ---GKYILEADVCWLNFDETKALQIFVSLASSFTAVNVLIII---VVLY------KMLIVRKQQN 568

  Fly   408 QQIND-QQMFAIFLRLFILMGLSWSFEILSFL 438
            ::.|. ..:..:.|.:..|.|::|...|.:.|
Zfish   569 KETNILPTVTRVVLIVSPLFGVTWGLGIGTML 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 23/97 (24%)
7tm_4 213..>385 CDD:304433 39/191 (20%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071 14/61 (23%)
7tm_4 374..620 CDD:304433 52/254 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.