DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18467 and RanBPM

DIOPT Version :9

Sequence 1:NP_611211.3 Gene:CG18467 / 36958 FlyBaseID:FBgn0034218 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_973963.1 Gene:RanBPM / 840440 AraportID:AT1G35470 Length:467 Species:Arabidopsis thaliana


Alignment Length:186 Identity:48/186 - (25%)
Similarity:81/186 - (43%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVMNYLVTEGYQEAAKRF-MTEASVKPGPHMD------------TIGDRLRIQDAVRVGQVKYAM 78
            ||..||:..||:|....| :...:..|..|:|            .:..|..::..||.|::..|:
plant   251 LVKTYLLHYGYEETLDAFNLATKNTVPPIHIDQENAIDEDDSSYALKQRKNLRQLVRNGEIDTAL 315

  Fly    79 DLATRIYPRLFETDNYV---FFHMQQLRLIEMIRDQKMEKALKFAQSKAA------GFSKVDPSH 134
            ....::||::.:.|..|   ..|.|  :.||::|..|:|:.:.:.:.:.|      ||..:    
plant   316 AELQKLYPQIVQDDKSVVCFLLHCQ--KFIELVRVGKLEEGVNYGRLELAKFVGLTGFQDI---- 374

  Fly   135 YHEVERTMGLLAFDRPEYSPYGELMYYSYRQKVAGEMNAAML-----------RCH 179
               ||....|||:::||.|.....:..|.|:.||..:|||:|           .||
plant   375 ---VEDCFALLAYEKPEESSVWYFLEDSQRELVADAVNAAILSTNPNKKDVQRSCH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18467NP_611211.3 LisH 23..48 CDD:285685 8/21 (38%)
CLTH 58..209 CDD:287564 37/142 (26%)
CTLH 58..115 CDD:128914 15/59 (25%)
CRA 111..213 CDD:214806 23/86 (27%)
RanBPMNP_973963.1 SPRY_RanBP_like 85..215 CDD:293943
CTLH 296..353 CDD:128914 15/58 (26%)
CRA 349..452 CDD:214806 23/86 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12864
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.