| Sequence 1: | NP_611211.3 | Gene: | CG18467 / 36958 | FlyBaseID: | FBgn0034218 | Length: | 237 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_188306.2 | Gene: | TPR2 / 820936 | AraportID: | AT3G16830 | Length: | 1131 | Species: | Arabidopsis thaliana |
| Alignment Length: | 195 | Identity: | 34/195 - (17%) |
|---|---|---|---|
| Similarity: | 78/195 - (40%) | Gaps: | 43/195 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 LVMNYLVTEGYQEAAKRFMTEA----SVKPGPHMDTIGDRLRIQDAV----RVGQVKYAMDLATR 83
Fly 84 IYPRLFETDNYVFFHMQQLRLIEMIRDQKMEKALKFAQSKAAGFSKVDPSHYHEVERTMGLLAF- 147
Fly 148 DRPEYSPYGE------LMYYS----------YRQKVA-GEMNAAMLRCHEDESKSKEEPM--EPR 193
Fly 194 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18467 | NP_611211.3 | LisH | 23..48 | CDD:285685 | 4/20 (20%) |
| CLTH | 58..209 | CDD:287564 | 28/160 (18%) | ||
| CTLH | 58..115 | CDD:128914 | 7/60 (12%) | ||
| CRA | 111..213 | CDD:214806 | 21/103 (20%) | ||
| TPR2 | NP_188306.2 | LisH | 4..34 | CDD:128913 | 5/22 (23%) |
| CTLH | 34..92 | CDD:128914 | 8/72 (11%) | ||
| CLTH | <71..>135 | CDD:402305 | 12/78 (15%) | ||
| WD40 | 348..657 | CDD:421866 | |||
| WD40 repeat | 352..407 | CDD:293791 | |||
| WD40 repeat | 413..451 | CDD:293791 | |||
| WD40 repeat | 456..493 | CDD:293791 | |||
| WD40 repeat | 500..536 | CDD:293791 | |||
| WD40 repeat | 543..583 | CDD:293791 | |||
| WD40 repeat | 591..628 | CDD:293791 | |||
| WD40 repeat | 635..657 | CDD:293791 | |||
| WD40 | 828..1087 | CDD:421866 | |||
| WD40 repeat | 835..869 | CDD:293791 | |||
| WD40 repeat | 876..912 | CDD:293791 | |||
| WD40 repeat | 918..958 | CDD:293791 | |||
| WD40 repeat | 1010..1052 | CDD:293791 | |||
| WD40 repeat | 1061..1088 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||