DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18467 and SPBC106.13

DIOPT Version :9

Sequence 1:NP_611211.3 Gene:CG18467 / 36958 FlyBaseID:FBgn0034218 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_595162.1 Gene:SPBC106.13 / 2540173 PomBaseID:SPBC106.13 Length:404 Species:Schizosaccharomyces pombe


Alignment Length:142 Identity:37/142 - (26%)
Similarity:70/142 - (49%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNRLVMNYLVTEGYQEAAKRFMTEASVKPGPHMDTIGDRLR---IQDAVRVGQVKYAMDLATRIY 85
            |||||.:|::..||..||.....::.::   ::..:|...|   |.|::...::|..:...:...
pombe   120 LNRLVADYMMANGYHGAAALLCKDS
QLE---NLVDLGIYKRYQLIHDSILQQELKEVLSWCSEHR 181

  Fly    86 PRLFETDNYVFFHMQQLRLIEMIRDQKMEKALKFAQSKAAGFSKVDPSHYHEVERTMGLLAFDRP 150
            ..|.:.::.:...::..|.||:|:.:|:.:|:.||:   |.|......|...::....||||  |
pombe   182 AILKKNNSTLELEVRLQRFIELIKSKKLCQAIAFAK---AHFGTWANEHPARLQLAAALLAF--P 241

  Fly   151 EY---SPYGELM 159
            |:   |||..|:
pombe   242 EFTNGSPYSLLL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18467NP_611211.3 LisH 23..48 CDD:285685 10/23 (43%)
CLTH 58..209 CDD:287564 27/108 (25%)
CTLH 58..115 CDD:128914 11/59 (19%)
CRA 111..213 CDD:214806 17/52 (33%)
SPBC106.13NP_595162.1 LisH 119..144 CDD:285685 10/23 (43%)
CLTH 154..296 CDD:287564 26/105 (25%)
CTLH 154..211 CDD:128914 10/56 (18%)
CRA 207..298 CDD:214806 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.