DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ARP4A

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001323058.1 Gene:ARP4A / 843728 AraportID:AT1G73910 Length:167 Species:Arabidopsis thaliana


Alignment Length:157 Identity:50/157 - (31%)
Similarity:81/157 - (51%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGGDEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNAD-- 69
            :|||||:.|:|.|.|.|:.:.|||.||:|||..|||||.......::|....|..:|..::.:  
plant     1 MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESDKEKG 65

  Fly    70 QRKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAY---ANVIQSEPE-YHPVLFSEA 130
            :||.|..:..:...|..||:.:..|||::.:||:.:.|.|:|:   :.:..:|.: :...|.|..
plant    66 KRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRASSELTAAERKVWFLYLLSML 130

  Fly   131 S----------WNV------RNNREKL 141
            |          ||:      |..||:|
plant   131 SSSWIRNRLFWWNIINAVIERTPRERL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 45/151 (30%)
ARP4ANP_001323058.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001878
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.