DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and DIS1

DIOPT Version :10

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_172777.1 Gene:DIS1 / 837876 AraportID:AT1G13180 Length:427 Species:Arabidopsis thaliana


Alignment Length:55 Identity:15/55 - (27%)
Similarity:21/55 - (38%) Gaps:20/55 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SCGAAPPADDSNEMHVVKTFHRGQQLSRKLKRRLTFRTRQELSALKKQSTEAVHV 228
            |.|:|  .|.||..|       |.|..|          |:.|:| ::...|..|:
plant    45 SKGSA--RDGSNSKH-------GSQAQR----------RESLNA-QEDRVEPCHL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 ASKHA_NBD_Arp4_ACTL6-like 10..416 CDD:466846 15/55 (27%)
DIS1NP_172777.1 ASKHA_NBD_Arp3-like 8..419 CDD:466822 15/55 (27%)

Return to query results.
Submit another query.