DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and AT2G42170

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:349 Identity:111/349 - (31%)
Similarity:188/349 - (53%) Gaps:46/349 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RSNMEVQTY-MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFE 147
            ||.:....| |:.|::.|||..||:..:.:.:.::..||.||||.:||..|.:.:|||:|::|||
plant    18 RSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKADREKMTQIMFE 82

  Fly   148 KYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCR 212
            .:.||:.::...|.|:..:|||.|..|:|||...:..||::||..|..|:::..|.|..|:....
plant    83 TFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIVPIYEGSALPHAILRLDLAGRHLTNYLM 147

  Fly   213 QHLEKHGIDLSPVYKIASKDVVKE--RDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQVL 275
            :.:.:.|      |..|.::||::  ...|...|                     |::..:.:..
plant   148 KIMMERG------YTSAEREVVRDIKEQFGYIAL---------------------DYEQEMEKAT 185

  Fly   276 ENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAMLG---AG--QLASTSVGMCDAD 335
            ::...:|.        ||.|:|.....|:|||:..|.||..:::|   :|  :....|:..||.|
plant   186 KSSAIDRT--------YELPDGQVITIGAERFRCPEVLFQPSLIGMETSGIHEKTYNSIMKCDDD 242

  Fly   336 VRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILASIG 400
            :|..|:|::|::||.|:.:|..||:.:::...|.:|.|:|:::   ..||::..|||||||||:.
plant   243 IRKDLYGNIVLSGGTTMFRGIEERMTKEINALAAANMRIKIVA---PPERKYSVWIGGSILASLS 304

  Fly   401 TFQQMWISSQEYEEAGKSQVERKC 424
            |::||||:..||||.|.:.|..||
plant   305 TYEQMWITKAEYEENGPAIVHTKC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 111/349 (32%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.