DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTL8

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_110439.2 Gene:ACTL8 / 81569 HGNCID:24018 Length:366 Species:Homo sapiens


Alignment Length:415 Identity:109/415 - (26%)
Similarity:178/415 - (42%) Gaps:74/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRK------FY 74
            ::.|.|...|:.|.|..:.|:...|::|......|           |..|:.|.:|.      .:
Human     6 VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKE-----------NPGPSYARRRVSLGIDICH 59

  Fly    75 VDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQS---EPEYHPVLFSEASWNVRN 136
            .||....:.|           |.|.||:    .:.|.::.|:::   |.|..||:.:|.......
Human    60 PDTFSYPIER-----------GRILNWE----GVQYLWSFVLENHRREQEVPPVIITETPLREPA 109

  Fly   137 NREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSP 201
            :|:|:.|::||..:||:..|.....::.::||..|.:|||||...|...|.|:|..|       |
Human   110 DRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPL-------P 167

  Fly   202 LGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQD 266
            ..|        :.||..|.||| .|.:  |.:.||..:.|...:.....:||..:.|:.|     
Human   168 ASG--------KTLEFAGQDLS-AYLL--KSLFKEDCDRRCLFQLETVAVTQMNKCYVPQ----- 216

  Fly   267 FQMNVLQVLENPFDERVAAQIPTVH-YEFPNGYH------QDFGSERFKIAESLFDNAMLGAGQL 324
               |:.:.|:  |.||..:.:...: |:.|:|..      |....|.| .:..:|:.......:.
Human   217 ---NLGEALD--FRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMF-FSPQVFEQPGPSIPRA 275

  Fly   325 ASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGA 389
            ...||..|:..:|..|...|:..|||||..||.:||.|:|.....|:|:..:...:   .|.|..
Human   276 IVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGS---NRNFSV 337

  Fly   390 WIGGSILASIGTFQQMWISSQEYEE 414
            |:|.|::|.:.|:|..|:|.:||.|
Human   338 WLGASVVAHLSTYQSEWMSREEYGE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 109/415 (26%)
ACTL8NP_110439.2 ACTIN 4..363 CDD:214592 109/415 (26%)
NBD_sugar-kinase_HSP70_actin 7..362 CDD:302596 108/412 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.