DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Ankrd36

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_076305.2 Gene:Ankrd36 / 76389 MGIID:1923639 Length:1415 Species:Mus musculus


Alignment Length:265 Identity:54/265 - (20%)
Similarity:98/265 - (36%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ETNLDPETKTDNNATPNNADQRKFYV----------DTNYVTV-PRSNMEVQTYMKDGMIDNWDL 103
            :.|::...:.::.|. ..|.||:..:          |:|.|.: ..:::....|.||..|     
Mouse    90 DCNIEARDREESTAL-IKATQRQHEICVKILLENGADSNAVDIHQNTSLHYTVYNKDTTI----- 148

  Fly   104 FEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFE-KYNVPAF------FLV---- 157
            ..|::.:.....::::..|.|::.:     |..|::::.||:.: ..|:.|.      .|:    
Mouse   149 AAKLLAFNADTEVKTKNGYTPLILA-----VLENKQEMVELLLQAAANINALDNCKRSALIHAVR 208

  Fly   158 ---KNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLE-KH 218
               ||.:......|...:||...|||..|........||||.....|   :..:::.|...: |.
Mouse   209 TQSKNMISLLLQQGANASLVDIYGATAQSYAVFETFQVLSQGPGPRP---ELTTKEARHSFDTKD 270

  Fly   219 G-IDLSPVYKIASKDVVKERDN----GRFTLRKLPEN-----------------------LTQS- 254
            | :..||.:|..:|.:.:..|.    |.|..|  |.|                       ||:| 
Mouse   271 GLVPCSPRFKEDNKRMEENTDAVDELGSFAHR--PSNSEPIEEEDEPSLSTKPPVVQSPVLTESN 333

  Fly   255 -WQNY 258
             |..|
Mouse   334 LWAGY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 54/265 (20%)
Ankrd36NP_076305.2 Ank_2 37..130 CDD:289560 7/40 (18%)
ANK repeat 37..64 CDD:293786
ANK 61..186 CDD:238125 19/106 (18%)
ANK repeat 68..97 CDD:293786 1/6 (17%)
ANK repeat 99..130 CDD:293786 6/31 (19%)
ANK repeat 132..163 CDD:293786 5/35 (14%)
Ank_2 137..229 CDD:289560 18/101 (18%)
ANK 162..>240 CDD:238125 18/82 (22%)
ANK repeat 165..196 CDD:293786 8/35 (23%)
ANK repeat 198..229 CDD:293786 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.