DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actrt1

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_082790.1 Gene:Actrt1 / 73360 MGIID:1920610 Length:376 Species:Mus musculus


Alignment Length:427 Identity:130/427 - (30%)
Similarity:202/427 - (47%) Gaps:79/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFY----- 74
            |::||.|....:||.:.|..|:..|.||||   .|:.|:           |:....||.|     
Mouse    11 AVIFDNGSGLCKVGISGEIEPRHVINSVVG---HPKFNI-----------PSARSNRKRYFVGEE 61

  Fly    75 ----VDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVR 135
                .|..|:..|         ::.|::..||..||:....:...:..:|...||..:|.|.|.:
Mouse    62 AQCMYDGLYLHYP---------IERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPQ 117

  Fly   136 NNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKS 200
            ..|||.||:||||:||||.:|..:||.|..:|...|.||:|||...|..|||:|||.|..|:.|.
Mouse   118 ETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPVYEGYSLPHAITKL 182

  Fly   201 PLGGDFLSRQCRQHLEKHGIDLSPVYK---IASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQL 262
            .:.|    |...:||.:  :.|:..|.   |.:|.||.:          :.|.|.      .:.|
Mouse   183 YVAG----RDITEHLTR--LLLAKGYTFPCILNKAVVDD----------IKEKLC------TVSL 225

  Fly   263 MMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLF--DNA---MLGAG 322
            ..:|.:.|..|.|..              |..|:|..........::.|.||  |:.   .||..
Mouse   226 GYKDTEKNCQQFLRK--------------YTLPDGNTIQMSDHLCQVPEVLFTPDHLGIHDLGIS 276

  Fly   323 QLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRF 387
            ::...|:..||.|::.:||..:|::||.|:..|..:||.::|:..|...|.:|:   ..|.:|.:
Mouse   277 KMVCNSIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKI---TASSDRCY 338

  Fly   388 GAWIGGSILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            .||||||::.|:.||:|||:::::::|.|...|:|||
Mouse   339 SAWIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 130/427 (30%)
Actrt1NP_082790.1 NBD_sugar-kinase_HSP70_actin 8..376 CDD:302596 130/427 (30%)
ACTIN 9..376 CDD:214592 130/427 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.