DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actl9

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 / 69481 MGIID:1916731 Length:415 Species:Mus musculus


Alignment Length:428 Identity:111/428 - (25%)
Similarity:193/428 - (45%) Gaps:67/428 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDEI----GALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQ 70
            ||.:    ||:|.|.|..:.:||:|.:..|...:.::  :|..|:          ..||.:.::.
Mouse    41 GDRLPPKTGAVVIDMGTGTCKVGFAGQSQPTYTVATI--LGCQPK----------KQATKDQSEL 93

  Fly    71 RKFYVDTNYVTVPRSNMEVQTY--MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWN 133
            ..|..:     ..||..|::..  :::|::.:|:..|.:..:...:.:|.....||:|||:..::
Mouse    94 ETFIGE-----AARSRPELRLVKPIRNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDPPFS 153

  Fly   134 VRNNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVV 198
            ...|||||.|:.||..:.||.::...:||:.::.||...||||:|...:..|||.:||.|..|:.
Mouse   154 PATNREKLVEVAFESLHSPALYVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQ 218

  Fly   199 KSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLM 263
            :..|.|:.|:....:.|...|                      |:|::...:|.::.:::...| 
Mouse   219 RLDLAGNHLTAFLAEMLLGSG----------------------FSLQQEDLDLVENIKHHYCYL- 260

  Fly   264 MQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDN------AMLGAG 322
            ..|||....:.     ||.....:     :.|:|.....|.|.|:..|.||..      :.:|..
Mouse   261 APDFQKEQARP-----DEECKQSL-----KLPDGRTVTLGKELFQCPELLFHPPEIPGLSPIGLP 315

  Fly   323 QLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRD-LQLRAPSNTRLKMISANGSVERR 386
            .:|..|:.....::|..:..:|::.||::|..|...|...: |...:|.:..:.|...|    |.
Mouse   316 AMAEQSLLKVPQELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPEDHVVVMAHPN----RN 376

  Fly   387 FGAWIGGSILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            ...|||||||||:..||..|:..::|||.|...|.|||
Mouse   377 LSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKC 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 109/425 (26%)
Actl9NP_899105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ACTIN 48..414 CDD:214592 107/419 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.