DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTA1

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001091.1 Gene:ACTA1 / 58 HGNCID:129 Length:377 Species:Homo sapiens


Alignment Length:419 Identity:141/419 - (33%)
Similarity:219/419 - (52%) Gaps:52/419 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYV 75
            ||..|||.|.|...::.|:|.:|:|:|..||:||             :..:........|:..||
Human     5 DETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVG-------------RPRHQGVMVGMGQKDSYV 56

  Fly    76 DTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREK 140
            . :.....|..:.::..::.|:|.|||..||:..:.:.|.::..||.||.|.:||..|.:.||||
Human    57 G-DEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

  Fly   141 LTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGD 205
            :|::|||.:||||.::...|||:.::|||.|.:|:|||...|..||::|||.|..|:::..|.|.
Human   121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGR 185

  Fly   206 FLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMN 270
            .|:....:.|.:.|...   ...|.:::|          |.:.|.|.         .:..||   
Human   186 DLTDYLMKILTERGYSF---VTTAEREIV----------RDIKEKLC---------YVALDF--- 225

  Fly   271 VLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAMLG---AG--QLASTSVG 330
                 ||......::......||.|:|.....|:|||:..|:||..:.:|   ||  :....|:.
Human   226 -----ENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIM 285

  Fly   331 MCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSI 395
            .||.|:|..|:.:.|::||.|:..|..:|:.:::...|||..::|:|:   ..||::..||||||
Human   286 KCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSI 347

  Fly   396 LASIGTFQQMWISSQEYEEAGKSQVERKC 424
            |||:.|||||||:.|||:|||.|.|.|||
Human   348 LASLSTFQQMWITKQEYDEAGPSIVHRKC 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 139/417 (33%)
ACTA1NP_001091.1 PTZ00281 4..377 CDD:173506 141/419 (34%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 112..125 6/12 (50%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 360..372 7/11 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.