DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and si:ch211-241j12.3

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_017207998.2 Gene:si:ch211-241j12.3 / 566552 ZFINID:ZDB-GENE-040724-72 Length:1245 Species:Danio rerio


Alignment Length:416 Identity:122/416 - (29%)
Similarity:202/416 - (48%) Gaps:59/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYV--DTN 78
            :|.|.|...::.|:|.:|.|.|..|:|:|             :.......|:...|:.||  |..
Zfish   881 IVLDSGSGLMKAGFADQDLPAAVFPTVIG-------------RPKYEEVMNSCVDRELYVGHDAQ 932

  Fly    79 YVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTE 143
            ::   |..:.::..::.|::.|||..|.:..:|: .::.:.||.||||.:||:.|...||:::.|
Zfish   933 HM---RGVLTLRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQRMVE 993

  Fly   144 LMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLS 208
            ||||.::||..|:...||||.::|||.|.:|:|||...:.:|||.|||.|..||.:..|.|..::
Zfish   994 LMFEAFSVPLTFVAVQAVLALYASGRTTGVVLDSGDGVSHSVPVFEGYCLPHAVQRLDLAGADVT 1058

  Fly   209 RQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQ 273
            .|.::.|.:.|:.|.   ..|..::|:|          :.|.......:|..::...:.:     
Zfish  1059 LQLQKLLLESGVCLR---TSAELEIVRE----------MKERCCFVSVDYEAEMKSSESE----- 1105

  Fly   274 VLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAMLGAG-----QLASTSVGMCD 333
                            :.|..|:|:.....|:||:..|.||...::|..     :....|:...|
Zfish  1106 ----------------IQYTLPDGHTVPLASQRFRAPEILFRPELIGRDHYGLHESVFRSILQSD 1154

  Fly   334 ADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILAS 398
            .|:|.|..|:::::||||||.|..|||..:::...|.:.. ..:..:...:|.|..|.||:.|||
Zfish  1155 LDLRRSFVGNILLSGGNTLLSGLAERLQLEVRAMVPLDLS-ACVRVSSPPDRDFSVWSGGAALAS 1218

  Fly   399 IGTFQQMWISSQEYEEAGKSQVERKC 424
            :...|..|||:.||||.|...|.|||
Zfish  1219 LPEQQSAWISAAEYEEFGPQIVFRKC 1244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 122/416 (29%)
si:ch211-241j12.3XP_017207998.2 Neuromodulin_N <411..625 CDD:331332
ACTIN 878..1245 CDD:214592 122/416 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.