| Sequence 1: | NP_611209.1 | Gene: | Bap55 / 36956 | FlyBaseID: | FBgn0025716 | Length: | 425 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005356.1 | Gene: | POTEG / 404785 | HGNCID: | 33896 | Length: | 508 | Species: | Homo sapiens |
| Alignment Length: | 198 | Identity: | 43/198 - (21%) |
|---|---|---|---|
| Similarity: | 71/198 - (35%) | Gaps: | 51/198 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 137 NREKLTELMF----EKYNVPAFFLVKNAVLAAFSSGRATALV------------------VDSGA 179
Fly 180 THTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTL 244
Fly 245 RKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQIP---TVHYEF----PNGYHQDF 302
Fly 303 GSE 305 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bap55 | NP_611209.1 | Actin | 13..425 | CDD:394979 | 43/198 (22%) |
| POTEG | NP_001005356.1 | Ank_4 | 143..193 | CDD:290365 | |
| ANK | 167..292 | CDD:238125 | 7/22 (32%) | ||
| ANK 1 | 172..201 | ||||
| ANK repeat | 174..203 | CDD:293786 | |||
| Ank_2 | 177..269 | CDD:289560 | 43/198 (22%) | ||
| ANK repeat | 205..236 | CDD:293786 | |||
| ANK 2 | 205..234 | ||||
| ANK | 233..357 | CDD:238125 | 20/87 (23%) | ||
| ANK repeat | 238..269 | CDD:293786 | 43/198 (22%) | ||
| ANK 3 | 238..267 | ||||
| Ank_2 | 243..335 | CDD:289560 | 15/65 (23%) | ||
| ANK repeat | 271..302 | CDD:293786 | 10/30 (33%) | ||
| ANK 4 | 271..300 | 9/28 (32%) | |||
| ANK repeat | 304..335 | CDD:293786 | 4/30 (13%) | ||
| ANK 5 | 304..333 | 4/28 (14%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 367..488 | 20/86 (23%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||