DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Arp3

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster


Alignment Length:436 Identity:108/436 - (24%)
Similarity:190/436 - (43%) Gaps:68/436 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALVFDPGHHSLRVGYAQEDSPKAEIPSVVGI---GAAPETNLDPETKTDNNATPNNADQRKFYVD 76
            |.|.|.|....::|:|....|:..|||.:.|   ....:||....||        ..:...|::.
  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITK--------GIEDLDFFIG 63

  Fly    77 ------TNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVR 135
                  |.|        .::..::.|::::|||.|:.::......:::|||.|..|.:|...|..
  Fly    64 DEAFDATGY--------SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

  Fly   136 NNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRA--------TALVVDSGATHTSAVPVHEGYV 192
            .|||...|:|||.:|||..::...||||..:|..:        |.:|||||...|..:||.||||
  Fly   121 ENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYV 185

  Fly   193 LSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQN 257
            :...:...|:.|..::...:..|.:..:.:.|...:.:...:||:.      ..:..::.:.:..
  Fly   186 IGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKH------CYICPDIAKEFAK 244

  Fly   258 YMLQ--LMMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAMLG 320
            |..:  ..:::|. .|..|.:.||:..|             ||.:..|.|.|...|....:..:.
  Fly   245 YDTEPGKWIRNFS-GVNTVTKAPFNVDV-------------GYERFLGPEIFFHPEFSNPDFTIP 295

  Fly   321 AGQLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVE- 384
            ..::....:..|..|||..|:.::|::||:|:.:.|..||.||::....:..|:....:.|.:: 
  Fly   296 LSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKP 360

  Fly   385 ------------RRFGAWIGGSILASIGTFQQMWISSQEYEEAGKS 418
                        :|:..|.|||:|||...|.|:..:...|||.|.|
  Fly   361 KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 108/436 (25%)
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 108/436 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.