Sequence 1: | NP_611209.1 | Gene: | Bap55 / 36956 | FlyBaseID: | FBgn0025716 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001131143.1 | Gene: | POTEC / 388468 | HGNCID: | 33894 | Length: | 542 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 45/211 - (21%) |
---|---|---|---|
Similarity: | 74/211 - (35%) | Gaps: | 62/211 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 NREKLTELMF----EKYNVPAFFLVKNAVLAAFSSGRATALV------------------VDSGA 179
Fly 180 THTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTL 244
Fly 245 RKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDF---GSER 306
Fly 307 FKIAESLFDNAMLGAG 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bap55 | NP_611209.1 | Actin | 13..425 | CDD:394979 | 45/211 (21%) |
POTEC | NP_001131143.1 | ANK 1 | 138..171 | ||
Ank_4 | 143..193 | CDD:290365 | |||
ANK | 167..292 | CDD:238125 | 7/22 (32%) | ||
ANK 2 | 172..201 | ||||
ANK repeat | 174..203 | CDD:293786 | |||
Ank_2 | 177..269 | CDD:289560 | 45/211 (21%) | ||
ANK repeat | 205..236 | CDD:293786 | |||
ANK 3 | 205..234 | ||||
ANK | 233..357 | CDD:238125 | 21/87 (24%) | ||
ANK repeat | 238..269 | CDD:293786 | 45/211 (21%) | ||
ANK 4 | 238..267 | ||||
Ank_2 | 243..335 | CDD:289560 | 16/65 (25%) | ||
ANK repeat | 271..302 | CDD:293786 | 10/30 (33%) | ||
ANK 5 | 271..300 | 9/28 (32%) | |||
ANK repeat | 304..335 | CDD:293786 | 5/30 (17%) | ||
ANK 6 | 304..333 | 5/28 (18%) | |||
ANK 7 | 337..373 | 11/49 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 369..494 | 19/97 (20%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |