DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actrt3

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001102412.1 Gene:Actrt3 / 365763 RGDID:1561457 Length:371 Species:Rattus norvegicus


Alignment Length:424 Identity:118/424 - (27%)
Similarity:201/424 - (47%) Gaps:76/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATP--------NNADQRK 72
            :|.|.|...::.|.|....|:...|:::|           .||..:.|..        :.|.:|:
  Rat     8 VVIDNGSGMIKAGLAGAREPQFVYPNILG-----------RTKNHSPAADSKQELRVGDQAQERR 61

  Fly    73 FYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNN 137
            .::..:|.            ::.|:|.:|...|.:..:.|...:...|...|||.:|.:.|...:
  Rat    62 SFLSISYP------------VERGLISSWGDMEIMWKHIYDYNLNLNPSDGPVLVTEPALNPLAD 114

  Fly   138 REKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPL 202
            |:.::|:.||...||||::...||||.|::|..|.||::|||..|..||:.|||.||..|     
  Rat   115 RQHISEVFFENLGVPAFYMSVQAVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGV----- 174

  Fly   203 GGDFLSRQCRQHLEKHGIDLSPVYKIASKD--VVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQ 265
                      :.|...||||:....:..||  ::..|...|.|:..:.||......||..:::.:
  Rat   175 ----------KQLNVAGIDLTNYLMMLLKDDGIMLLRTGDRKTVTDIKENACYVAMNYDEEMVKE 229

  Fly   266 DFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAML-----GAGQLA 325
            .   ||.::                 |..|:|.......:.|:..|:||...::     |..::.
  Rat   230 S---NVEKM-----------------YTLPDGKTVKLRKQVFRCPEALFSPYLVNVDAPGIDRIC 274

  Fly   326 STSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAW 390
            .:|:..||||:|.|.|.:::::||:|...|..:||.:|:...||:||.:::::   ..||:...|
  Rat   275 FSSIMKCDADLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPANTTVQVVA---PPERKISVW 336

  Fly   391 IGGSILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            :|||||||:..||.|||::.|:||.|.:.|.::|
  Rat   337 MGGSILASLSAFQDMWITAAEFEEVGPNIVHQRC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 118/424 (28%)
Actrt3NP_001102412.1 ACTIN 5..371 CDD:214592 118/424 (28%)
NBD_sugar-kinase_HSP70_actin 9..371 CDD:302596 118/423 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.