DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actr3b

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001178789.1 Gene:Actr3b / 362298 RGDID:1565759 Length:418 Species:Rattus norvegicus


Alignment Length:439 Identity:112/439 - (25%)
Similarity:189/439 - (43%) Gaps:78/439 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYVDTNYVT 81
            |.|.|....::|||....|:..|||.:.|..:.:. :|...:    ......|...|::....:.
  Rat     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKV-VDQAQR----RVLRGVDDLDFFIGDEAID 68

  Fly    82 VPRSNMEVQTY-----MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKL 141
            .|       ||     ::.|::::|||.|:.::......:::|||.|..|.:|...|...|||.|
  Rat    69 KP-------TYATKWPIRHGIVEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYL 126

  Fly   142 TELMFEKYNVPAFFLVKNAVLAAFSSGRA--------TALVVDSGATHTSAVPVHEGYVLSQAVV 198
            .|:|||.:|||..::...||||..:|..:        |.:|:|||...|..:||.||||:...:.
  Rat   127 AEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIK 191

  Fly   199 KSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLM 263
            ..|:.|..::...:|.|.:..:.:.|...:.:...:||:                  ..|:...:
  Rat   192 HIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEK------------------YCYICPDI 238

  Fly   264 MQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQ-----DFGSERFKIAESLFDNAMLGAGQ 323
            :::|       .:...|.|...:    .|...|..:|     |.|.|||...|..|.........
  Rat   239 VKEF-------AKYDVDPRKWIK----QYTGINAINQRKFIIDVGYERFLGPEIFFHPEFANPDF 292

  Fly   324 LASTS------VGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGS 382
            :.|.|      :..|..|||..|:.::|::||:|:.:.|..||.|||:....:..:|....:.|.
  Rat   293 MESISDVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGR 357

  Fly   383 VE-------------RRFGAWIGGSILASIGTFQQMWISSQEYEEAGKS 418
            ::             :|:..|.|||:|||...|.|:..:.::|||.|.|
  Rat   358 IKPKPVEVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 112/439 (26%)
Actr3bNP_001178789.1 PTZ00280 2..417 CDD:240343 112/439 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.