DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and actr6

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_955990.1 Gene:actr6 / 324822 ZFINID:ZDB-GENE-030131-3543 Length:396 Species:Danio rerio


Alignment Length:460 Identity:95/460 - (20%)
Similarity:179/460 - (38%) Gaps:116/460 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRK----- 72
            :..||.|.|.:..::||:.|.           :...|.:....:|......|.|..|:.|     
Zfish     1 MSTLVLDNGAYFAKIGYSHEK-----------VSVIPNSQFRTKTSRLKTFTANQLDEIKDPSGL 54

  Fly    73 FYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKV-----------IDYAYANVIQSEPEYHPVL 126
            ||:      :|         .:.|.:.|||:..||           :|:|..|::.:||.:    
Zfish    55 FYI------LP---------FQKGYLVNWDVQRKVWDHLFGKEMFKVDFADTNIVITEPYF---- 100

  Fly   127 FSEASWNVRNNREKLTELMFEKYNVPAFFLVKNAVLAAF-----SSGRATALVVDSGATHTSAVP 186
                  |..:.:|.:.|::||:|...:...:....|:|.     ::.....:|||||.:.|..||
Zfish   101 ------NFCSIQESMNEILFEEYQFQSALRINAGSLSAHRYFHENNSELCCIVVDSGFSFTHIVP 159

  Fly   187 VHEGYVLSQAVVKSPLGGDFLSRQCRQ---HLEKHGIDLSPVYKIASKDV--------------- 233
            ...|..:...:.:..:||..|:...::   :.:.|.:|.:.|.....:||               
Zfish   160 YCRGRKMKGGICRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYVSQDFYKDMEIAQ 224

  Fly   234 VKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGY 298
            :|..||                      .:|:|:.:.....::..|.:      |.....|...|
Zfish   225 LKGEDN----------------------TVMKDYVLPDFSSIKKGFCK------PLEEMNFTGKY 261

  Fly   299 HQD-----FGSERFKIAESLFDNAMLGAGQLA-----STSVGMCDADVRLSLFGSVVVTGGNTLL 353
            ...     ..:|||.:.|.||..:.:|..::.     ..|:.....:::...:.::|:||||||.
Zfish   262 KTGEQILRLTNERFAVPEMLFHPSDIGIQEMGIPEALVNSINNMPEEMQPHFYKNIVLTGGNTLF 326

  Fly   354 QGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILASIGTFQQMWISSQEYEEAGKS 418
            .||.:|:.::::..||....:.::..|..:   ..:|.||.:||....|::|.::..:|||.|..
Zfish   327 PGFRDRVYKEVRALAPVEYDVSVVLPNNPI---CYSWEGGKLLAENPDFEEMAVTRDDYEENGHY 388

  Fly   419 QVERK 423
            ..|.|
Zfish   389 ICEEK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 95/460 (21%)
actr6NP_955990.1 ACTIN 2..394 CDD:214592 95/459 (21%)
COG5277 2..393 CDD:227602 94/457 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.