DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actrt1

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001013983.1 Gene:Actrt1 / 302796 RGDID:1359559 Length:376 Species:Rattus norvegicus


Alignment Length:428 Identity:129/428 - (30%)
Similarity:197/428 - (46%) Gaps:81/428 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFY----- 74
            |::||.|....:||.:.|..|:..|.||||   .|:.|:           |:....||.|     
  Rat    11 AVIFDNGSGLCKVGISGEIVPRHVINSVVG---HPKFNI-----------PSARSNRKRYFVGEE 61

  Fly    75 ----VDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVR 135
                .|..|:..|         ::.|::..||..||:....:...:..:|...||..:|.|.|.|
  Rat    62 AQCMYDGLYLHYP---------IERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPR 117

  Fly   136 NNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKS 200
            ..|||.||:||||:||||.:|..:||.|..:|...|.||:|||...|..||::|||.|.:|:.|.
  Rat   118 ETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPIYEGYSLPRAITKL 182

  Fly   201 PLGGDFLSRQCRQHLEK----HGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQ 261
            .:.|    |...:||.:    .|.....:...|..|.:||         ||   .|.||.:.   
  Rat   183 YVAG----RDITEHLTRLLLAKGYTFPCILNKAVVDDIKE---------KL---CTVSWGSK--- 228

  Fly   262 LMMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQDFGSERFKIAESLFDNAM-----LGA 321
                              |.....|.....|:.|:|..........::.|.||....     ||.
  Rat   229 ------------------DSEKCYQRSLSEYKLPDGNTIQMSDHLCQVPEVLFTPEHLGIHDLGI 275

  Fly   322 GQLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERR 386
            .::...|:..||.|::.:||..:|::||.||..|..:||.::|::.|...|.:|:   ..|.:|.
  Rat   276 SKMVCNSIMKCDTDIQENLFAEIVLSGGTTLFPGLQDRLLKELEVLAFEGTPIKI---TASPDRC 337

  Fly   387 FGAWIGGSILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            :.||||||::.|:.||:|||:::::::|.|...|:|||
  Rat   338 YSAWIGGSVMTSLTTFKQMWVTAEDFKEYGAFVVQRKC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 129/428 (30%)
Actrt1NP_001013983.1 ACTIN 9..376 CDD:214592 129/428 (30%)
NBD_sugar-kinase_HSP70_actin 11..376 CDD:302596 129/428 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.