DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actr10

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001009602.1 Gene:Actr10 / 299121 RGDID:1306515 Length:417 Species:Rattus norvegicus


Alignment Length:434 Identity:100/434 - (23%)
Similarity:175/434 - (40%) Gaps:78/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGGDEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQR 71
            |..|.|..|:|.|.|....:.|:|.|..|:..||||:              |....:.|....| 
  Rat     7 LGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI--------------KRAGMSKPIKVVQ- 56

  Fly    72 KFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRN 136
             :.::|.         |:.:|:|:           .|...|...:...|....|:..|:.....:
  Rat    57 -YNINTE---------ELYSYLKE-----------FIHILYFRHLLVNPRDRRVVVIESVLCPSH 100

  Fly   137 NREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSP 201
            .||.||.::|:.:.||:..|..:.::|..:.|..:|:|:|.|...:..:|::||..:.......|
  Rat   101 FRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALP 165

  Fly   202 LGGDFLSRQCR-QHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQ 265
            |||..|.::.. |.||:..:|.......:...|          :..:||::.:..:  :....:.
  Rat   166 LGGKALHKELETQLLEQCTVDTGAAKGQSLPSV----------MGSVPESVLEDIK--VRTCFVS 218

  Fly   266 DFQMNV-LQVLENPFDERVAAQIPTVHYEFP-NG---YHQDFGSERFKIAESLF--DNAMLGAGQ 323
            |.|..: :|..:...|.......|..:.::| :|   .|. .||.|..:.|.||  ||.......
  Rat   219 DLQRGLQIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHV-LGSIRDSVVEILFEQDNEEKSVAT 282

  Fly   324 LASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQ--LRAP--------SNTRLKMIS 378
            |...|:..|..|.|..|..::|:.||.::|.||..||..:::  :..|        .|.|:....
  Rat   283 LILDSLLQCPVDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPP 347

  Fly   379 ANGSVERRFGAWIGGSILASIGTFQQMW----ISSQEYEEAGKS 418
            |..:..    ||:||::   .|..|.:.    ||.:.|.:.|::
  Rat   348 AKANCV----AWLGGAV---FGALQDILGSRSISKEYYNQTGRT 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 97/428 (23%)
Actr10NP_001009602.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:418402 92/406 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.