DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTL9

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens


Alignment Length:421 Identity:116/421 - (27%)
Similarity:193/421 - (45%) Gaps:65/421 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYVDTN 78
            ||:|.|.|..:.:||:|.:.||...:.::  :|..|:          ..||...:..:.|..:..
Human    50 GAVVIDMGTGTCKVGFAGQASPTYTVATI--LGCQPK----------KPATSGQSGLQTFIGEAA 102

  Fly    79 YVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTE 143
            .| :|...: ||. ::.|::.:||..|.:..:...:.::.....||:|||:..::...|||||.|
Human   103 RV-LPELTL-VQP-LRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVE 164

  Fly   144 LMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLS 208
            :.||....||.::...:||:.::.||.:.||||:|...|..|||.:||.|..|..:..|.|:.|:
Human   165 VAFESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLT 229

  Fly   209 RQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQ 273
            ....:.|.:.|:.|      ..:|:            .|.||:...:     ..:..|||....:
Human   230 AFLAEMLLQAGLPL------GQQDL------------DLVENIKHHY-----CYVASDFQKEQAR 271

  Fly   274 VLENPFDERVAAQIPTVHY----EFPNGYHQDFGSERFKIAESLFDN------AMLGAGQLASTS 328
                          |...|    :.|:|.....|.|.|:..|.||:.      :.:|...:|..|
Human   272 --------------PEQEYKRTLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQS 322

  Fly   329 VGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGG 393
            :.....::|..|..:|::.||::|..||..|...:|....|:.|.: :::|..:  |.|..||||
Human   323 LRKLSLEMRADLAQNVLLCGGSSLFTGFEGRFRAELLRALPAETHV-VVAAQPT--RNFSVWIGG 384

  Fly   394 SILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            |||||:..||..|:..::|||.|...|.|||
Human   385 SILASLRAFQSCWVLREQYEEQGPYIVYRKC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 116/421 (28%)
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 116/421 (28%)
ACTIN 49..415 CDD:214592 114/419 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.