Sequence 1: | NP_611209.1 | Gene: | Bap55 / 36956 | FlyBaseID: | FBgn0025716 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129685.1 | Gene: | POTEH / 23784 | HGNCID: | 133 | Length: | 545 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 43/198 - (21%) |
---|---|---|---|
Similarity: | 72/198 - (36%) | Gaps: | 51/198 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 NREKLTELMF----EKYNVPAFFLVKNAVLAAFSSGRATALV------------------VDSGA 179
Fly 180 THTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTL 244
Fly 245 RKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQIP---TVHYEFP----NGYHQDF 302
Fly 303 GSE 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bap55 | NP_611209.1 | Actin | 13..425 | CDD:394979 | 43/198 (22%) |
POTEH | NP_001129685.1 | Ank_4 | 180..230 | CDD:290365 | |
ANK 1 | 180..208 | ||||
ANK | 204..329 | CDD:238125 | 7/22 (32%) | ||
ANK 2 | 209..238 | ||||
ANK repeat | 211..240 | CDD:293786 | |||
Ank_2 | 214..306 | CDD:289560 | 43/198 (22%) | ||
ANK repeat | 242..273 | CDD:293786 | |||
ANK 3 | 242..271 | ||||
ANK | 270..394 | CDD:238125 | 20/87 (23%) | ||
ANK repeat | 275..306 | CDD:293786 | 43/198 (22%) | ||
ANK 4 | 275..304 | ||||
Ank_2 | 280..372 | CDD:289560 | 15/65 (23%) | ||
ANK repeat | 308..339 | CDD:293786 | 10/30 (33%) | ||
ANK 5 | 308..337 | 9/28 (32%) | |||
ANK repeat | 341..372 | CDD:293786 | 4/30 (13%) | ||
ANK 6 | 341..370 | 4/28 (14%) | |||
ANK 7 | 374..404 | 8/43 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 406..524 | 19/84 (23%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |