DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTL10

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens


Alignment Length:270 Identity:71/270 - (26%)
Similarity:122/270 - (45%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGI 220
            :...|:||..|:|..:.|.|::||....|.|::.|:...||..:..:.|..|||..|..|     
Human     1 MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLL----- 60

  Fly   221 DLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAA 285
                  ..|:.|::::         .||.......:.....:.: ||:.:    |.:|.....|:
Human    61 ------VAANPDLLQQ---------ALPRKAITHLKKRSCYVSL-DFEGD----LRDPARHHPAS 105

  Fly   286 QIPTVHYEFPNGYHQDFGSERFKIAESLFDNAMLGAGQ-----LASTSVGMCDADVRLSLFGSVV 345
                  :...||......||||:..|.:|...:||..:     ||..::......:|..|..:||
Human   106 ------FSVGNGCCVCLSSERFRCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVV 164

  Fly   346 VTGGNTLLQGFPERLNRDLQLRAPSN----TRLKMISANGSVERRFGAWIGGSILASIGTFQQMW 406
            :.||:||..||.|||:::|:.:...:    .|..:::.:|   |....|.|||::||:.:||:.|
Human   165 LAGGSTLFPGFAERLDKELEAQCRRHGYAALRPHLVAKHG---RGMAVWTGGSMVASLHSFQRRW 226

  Fly   407 ISSQEYEEAG 416
            |:...|:|.|
Human   227 ITRAMYQECG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 71/270 (26%)
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.