DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTL7A

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_006678.1 Gene:ACTL7A / 10881 HGNCID:161 Length:435 Species:Homo sapiens


Alignment Length:421 Identity:115/421 - (27%)
Similarity:189/421 - (44%) Gaps:68/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAP--ETNLDPETKTDNNATPNNADQRKFYVDT 77
            |:|.|.|....:.|:|....|..:|.:.||   .|  ||     .||.:|.......|     :.
Human    71 AVVVDLGTGYCKCGFAGLPRPTHKISTTVG---KPYMET-----AKTGDNRKETFVGQ-----EL 122

  Fly    78 NYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLT 142
            |...|   ::::...::.|:|.:||..:.:.:|.:...::..||.|.||.|:...:...||||..
Human   123 NNTNV---HLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYA 184

  Fly   143 ELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFL 207
            |::||.:|.||..:...:.|:.:|.||.:.|||:.|...:..||::|||.|.....:        
Human   185 EMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGR-------- 241

  Fly   208 SRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVL 272
                   |:..|.||: .|.:.             .|.......||....     :::|.:....
Human   242 -------LDYAGSDLT-AYLLG-------------LLNSAGNEFTQDQMG-----IVEDIKKKCC 280

  Fly   273 QVLENPFDERVAAQIP----TVHYEFPNGYHQDFGSERFKIAESLFDNAMLGAGQL-----ASTS 328
            .|..:|.:|:   ::|    |:.|..|:|.......|||..:|..|..:::.:.||     ..:.
Human   281 FVALDPIEEK---KVPLSEHTIRYVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSC 342

  Fly   329 VGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGG 393
            :..||..::..|.|::::.||:|:|.|||.||.::|....|::|.    ..|...||....|.||
Human   343 LNKCDIALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDTP----QVNVLPERDSAVWTGG 403

  Fly   394 SILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            |||||:..||.:|:...||||.|...:.|:|
Human   404 SILASLQGFQPLWVHRFEYEEHGPFFLYRRC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 115/421 (27%)
ACTL7ANP_006678.1 ACTL7A_N 1..65 CDD:293445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
Required for interaction with TES 31..51
NBD_sugar-kinase_HSP70_actin 67..435 CDD:302596 115/421 (27%)
ACTIN 69..435 CDD:214592 115/421 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.