DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTL7B

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_006677.1 Gene:ACTL7B / 10880 HGNCID:162 Length:415 Species:Homo sapiens


Alignment Length:435 Identity:119/435 - (27%)
Similarity:197/435 - (45%) Gaps:89/435 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYVD 76
            :|.|::.|.|....:.|||.|..|...|.|.|| ...||             ..:..|.||:.:.
Human    48 KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG-KRCPE-------------AADAGDTRKWTLV 98

  Fly    77 TNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKL 141
            .:.:....:.:::...:|.|::.:||..:.:.:|.:...::..||.|.||.|:...:..:||||.
Human    99 GHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKY 163

  Fly   142 TELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSP-LGGD 205
            .|||||.:.:||..:...::|:.:|.|:.:.|||:||...:..||:.||.||.....::. .|||
Human   164 AELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGD 228

  Fly   206 FLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQ----- 265
                                                         ||    ||::||:.:     
Human   229 ---------------------------------------------LT----NYLMQLLNEAGHAF 244

  Fly   266 -DFQMNVLQVLENP------FDERVAAQIP---TVHYEFPNGYHQDFGSERFKIAESLFDNAMLG 320
             |..:::::.::..      ..|.....:|   .|.||.|:|.....|.|||:.:|.||..::.|
Human   245 TDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAG 309

  Fly   321 AGQ-----LASTSVGMC-DADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISA 379
            :.|     |.:..:|.| |...:..:..:|::.||.|:|.|||||..|:|.|..|.::.    :.
Human   310 STQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSP----AV 370

  Fly   380 NGSVERRFGAWIGGSILASIGTFQQMWISSQEYEEAGKSQVERKC 424
            ..:.||:...|.|||||||:..|||:|:|.:|:||.|...:..||
Human   371 AAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 119/434 (27%)
ACTL7BNP_006677.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
NBD_sugar-kinase_HSP70_actin 51..415 CDD:327376 116/430 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.