DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and ACTR3

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_005712.1 Gene:ACTR3 / 10096 HGNCID:170 Length:418 Species:Homo sapiens


Alignment Length:448 Identity:111/448 - (24%)
Similarity:186/448 - (41%) Gaps:92/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQRKFYVDTNY 79
            |.|.|.|....::|||....|:..|||.:.|..:.:.....:.:     .....|...|::....
Human     7 ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRR-----VMKGVDDLDFFIGDEA 66

  Fly    80 VTVPRSNMEVQTY-----MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNRE 139
            :..|       ||     ::.|::::|||.|:.::......:::|||.|..|.:|...|...|||
Human    67 IEKP-------TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124

  Fly   140 KLTELMFEKYNVPAFFLVKNAVLAAFSSGRA--------TALVVDSGATHTSAVPVHEGYVLSQA 196
            ...|:|||.:|||..::...||||..:|..:        |..|:|||...|..:||.||||:...
Human   125 YTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSC 189

  Fly   197 VVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQ 261
            :...|:.|..::...:|.|....:.:.|...:.:...||||                  .:|:..
Human   190 IKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKER------------------YSYVCP 236

  Fly   262 LMMQDFQ---------------MNVLQVLENPFD---ERVAAQIPTVHYEFPNGYHQDFGSERFK 308
            .::::|.               :|.:...|...|   ||........|.||.|   .||.....:
Human   237 DLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFAN---PDFTQPISE 298

  Fly   309 IAESLFDNAMLGAGQLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERLNRDLQLRAPSNTR 373
            :.:.:..|               |..|||..|:.::|::||:|:.:.|..||.|||:....:..:
Human   299 VVDEVIQN---------------CPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLK 348

  Fly   374 LKMISANGSVE-------------RRFGAWIGGSILASIGTFQQMWISSQEYEEAGKS 418
            |....:.|.::             :|:..|.|||:|||...|.|:..:.::|||.|.|
Human   349 LSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 111/448 (25%)
ACTR3NP_005712.1 PTZ00280 2..417 CDD:240343 111/448 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.