DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap55 and Actl10

DIOPT Version :9

Sequence 1:NP_611209.1 Gene:Bap55 / 36956 FlyBaseID:FBgn0025716 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:350 Identity:93/350 - (26%)
Similarity:144/350 - (41%) Gaps:77/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVPAFFLV 157
            :|.|::.:||..|.:.:......:|..||..|||.|::.......|||:.||:||...|||..:.
  Rat    27 IKHGVVVDWDALEGLWERLMVGGLQIHPEQWPVLVSDSPSAPPEGREKVAELLFEALTVPACHMA 91

  Fly   158 KNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDL 222
            ..|:||..|.|..:.|.|::||....|.|::.|:...:|..:..:.|..|||..|..|.....||
  Rat    92 STALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVASCPDL 156

  Fly   223 SPVYKIASKDVVKERDNGRFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQI 287
            .                    |..||.......:.....:.: |||.::..              
  Rat   157 Q--------------------LHALPRKTVTQLKKRCCYVSL-DFQGDICD-------------- 186

  Fly   288 PTVH----YEFPNGYHQDFGSERFKIAESLFDNAMLGAGQ-----LASTSVGMCDADVRLSLFGS 343
            |..|    :....|.:...|||||:..|.:|..::||..:     ||..::......:|..|..:
  Rat   187 PARHQRACFCLGKGCYVRLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANT 251

  Fly   344 VVVTGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFG-----------------AWI 391
            ||:.||:||..||.||:|.:||.:.                ||.|                 .|.
  Rat   252 VVLAGGSTLFPGFVERMNLELQAQC----------------RRHGYPALQPCLVAHPGRGTAVWT 300

  Fly   392 GGSILASIGTFQQMWISSQEYEEAG 416
            |||::||:.:||:.|::...|:|.|
  Rat   301 GGSMMASLHSFQRRWMTRAMYQEYG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap55NP_611209.1 Actin 13..425 CDD:394979 92/349 (26%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 92/349 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.