DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtap and Pnp2

DIOPT Version :9

Sequence 1:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011243453.2 Gene:Pnp2 / 667034 MGIID:3712328 Length:337 Species:Mus musculus


Alignment Length:269 Identity:66/269 - (24%)
Similarity:115/269 - (42%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIGIIGGSGLD------------DPDILEQRQERVVETPYGEPSDALIEGEINGVQCVLLARHGR 69
            ::.:|.||||.            |.:.:....:..|:...|.    |:.|.:||..||::  .||
Mouse    73 QVAVICGSGLGGLTAHLKAAQIFDYNEIPNFPQSTVQGHAGR----LVFGLLNGRSCVMM--QGR 131

  Fly    70 KH---DIMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQTFY 131
            .|   ....|.|.:...::.|  :|...|:|:.|.|.|....:.|::::..|.|:......|...
Mouse   132 FHMYEGYSLSEVTFPVRVFHL--LGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFCGQNPL 194

  Fly   132 DGKAQSPRGVCHLPMFPAFSERTRNILLQAAKEL-EIPAHDKATIVTIEGPRFSSRSESHMFRQW 195
            .|......||....|..|:....|.....|.|:: |.....:.|.|.:.||.|.:.:||.:.:..
Mouse   195 RGPNDERFGVRFPAMSDAYDRDMRQKAFSAWKQMGEQRKLQEGTYVMLAGPNFETVAESRLLKML 259

  Fly   196 GGDLINMTTCPEVVLAKEAGLLYGSVAIAT-----DYDCWRMGCEGVNVQDVL---RTFAENVIK 252
            |.|.:.|:|.|||::|:..||.....::.|     ||:    ..|..|.::||   :..|:.:.:
Mouse   260 GADAVGMSTVPEVIVARHCGLRVFGFSLITNMVVMDYE----NLEKANHKEVLDAGKAAAQKLER 320

  Fly   253 VKKILVNAV 261
            ...||:.::
Mouse   321 FVSILMESI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 66/269 (25%)
PNP_UDP_1 17..263 CDD:294213 66/269 (25%)
Pnp2XP_011243453.2 PNP-EcPNPII_like 55..323 CDD:350160 64/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.