DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtap and pnp4a

DIOPT Version :9

Sequence 1:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001002102.1 Gene:pnp4a / 415192 ZFINID:ZDB-GENE-040625-83 Length:291 Species:Danio rerio


Alignment Length:297 Identity:70/297 - (23%)
Similarity:122/297 - (41%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIGIIGGSGLDD-PDILE-QRQERVVETPYGEPSDA-------LIEGEINGVQCVLLARHGRKH- 71
            |:.||.||||.. .|.|: |...:..:.| |.|...       |:.||:.|..||.:  .||.| 
Zfish    28 KVAIICGSGLGMLADGLKCQDSFKYSDIP-GFPQSTVKGHAGRLVFGELKGKTCVCM--QGRFHM 89

  Fly    72 --DIMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQTFYDGK 134
              ....|.|.:...::.|  :|...|||:.|.|||.:....|::::..|.|:         :.|.
Zfish    90 YEGHSLSKVTFPVRVFKL--LGVDTLIVTNAAGSLADSYNCGDIMIIRDHIN---------FPGL 143

  Fly   135 A-----QSPRGVCHLPMFP----AFSERTRNILLQAAKELEIPAH-DKATIVTIEGPRFSSRSES 189
            |     ..|......|.||    .:....|.:.|...|.:.:..: .:.....:.||.|.|.:|:
Zfish   144 AGLNPLNGPNDEKFGPRFPPMSGVYDRGLRKMALDICKGMGVSQYVQEGVYCMVGGPNFESIAEA 208

  Fly   190 HMFRQWGGDLINMTTCPEVVLAKEAGLLYGSVAIATDYDCWRMGCEGVNVQDVLRTFAEN----- 249
            .:..:.|.|.:.|:|.|||::|...|:....:::.|:              .|::::.:|     
Zfish   209 RLLHRLGVDAVGMSTAPEVLVASHCGIRVFGLSLITN--------------KVVKSYEDNETVNH 259

  Fly   250 --VIKVKKILVNAVGRIAKEDWSEDILNAKQCVCNNT 284
              |::|.|:....:..:..|      |.::..:.|||
Zfish   260 EAVLEVSKMRSETLQALVTE------LISRMDINNNT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 65/275 (24%)
PNP_UDP_1 17..263 CDD:294213 65/274 (24%)
pnp4aNP_001002102.1 PRK08202 9..284 CDD:236183 67/289 (23%)
XapA 13..284 CDD:223084 67/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.