DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtap and pnp6

DIOPT Version :9

Sequence 1:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_991218.2 Gene:pnp6 / 402953 ZFINID:ZDB-GENE-040426-1800 Length:286 Species:Danio rerio


Alignment Length:272 Identity:77/272 - (28%)
Similarity:127/272 - (46%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLDPLPVKIGIIGGSGLDD-PDILEQRQ----ERVVETPYGE---PSDALIEGEINGVQCVLLAR 66
            |.|..| |:.||.||||.. .|:|:.:|    :::...|:..   ....|:.||:||.|||.:  
Zfish    24 NTDIRP-KVAIICGSGLGGLADLLDNKQVFSYDKIPRFPHSTVQGHKGQLVFGELNGKQCVCM-- 85

  Fly    67 HGRKHDIMPSN---VNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQ 128
            .||.|.....|   |.|...::.|  :|...|||:.|.|.|..:.|.|:::|..|.|:......|
Zfish    86 QGRFHFYEGYNVATVTYPVRVFFL--LGIETLIVTNAAGGLNPKFKVGDIMVIKDHINMPGFAGQ 148

  Fly   129 TFYDGKAQSPRGVCHLPMFPAFSERTRNILLQAAKELEIPAH-DKATIVTIEGPRFSSRSESHMF 192
            ....|..:...||....|..|:......::.:.||||...:. .:.....:.||.:.:.:|..:.
Zfish   149 NPLCGHNEERFGVRFPCMSDAYDRDLAQLVRKTAKELGCDSFLQEGVYCMLAGPSYETIAECRVL 213

  Fly   193 RQWGGDLINMTTCPEVVLAKEAGL-LYG----SVAIATDYDCWRMGCEGVNVQDVLRTFAENVIK 252
            :..|.|.:.|:|.||||:|:..|: ::|    :..:.||||    ..|..|.::||.|.......
Zfish   214 QMLGADAVGMSTVPEVVIARHCGIRVFGLSLITNKVVTDYD----SKERANHEEVLETTRMRTED 274

  Fly   253 VKKILVNAVGRI 264
            :::|:.|.|.::
Zfish   275 LQRIVSNVVRKM 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 76/268 (28%)
PNP_UDP_1 17..263 CDD:294213 74/262 (28%)
pnp6NP_991218.2 PRK08202 11..286 CDD:236183 77/270 (29%)
XapA 16..286 CDD:223084 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.