DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtap and CG16758

DIOPT Version :9

Sequence 1:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001261330.1 Gene:CG16758 / 38315 FlyBaseID:FBgn0035348 Length:396 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:105/251 - (41%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KDTNLDPLPVKIGIIGGSGL-------DDPDILEQRQERV----VETPYGEPSDALIEGEINGVQ 60
            |.:.:.|   |||||.||||       .||.|.|  .|::    |.|..|. :..|:.|.:.|  
  Fly   126 KGSGMRP---KIGIICGSGLGSLADMIQDPKIFE--YEKIPNFPVSTVEGH-AGRLVVGTLEG-- 182

  Fly    61 CVLLARHGRKHDI---------MPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVP 116
            ..::|..||.|..         ||..|        ::..|..:|..:.|.|.:......|::::.
  Fly   183 ATVMAMQGRFHFYEGYPLAKCSMPVRV--------MKLCGVEYLFATNAAGGINPRFAVGDIMLM 239

  Fly   117 HDFIDRTTKRLQTFYDGKAQSPRGVCHLPMFPA----FSERTRNILLQAAKELEIPAHDKATIVT 177
            ||.::    .|....:...|.|......|.|||    :::...|..::.||.:.|.::....:.:
  Fly   240 HDHVN----MLGFAGNSPLQGPNDPRFGPRFPALVNSYNKDLINKAIEIAKAMGIESNIHVGVYS 300

  Fly   178 -IEGPRFSSRSESHMFRQWGGDLINMTTCPEVVLAKEAGLLYGSVAI-----ATDY 227
             :.||.:.:.:|....|..|.|.:.|:|..||:.|:...:...:.::     ||:|
  Fly   301 CLGGPNYETIAELKALRMMGVDAVGMSTVHEVITARHCDMKVFAFSLITNKCATEY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 60/246 (24%)
PNP_UDP_1 17..263 CDD:294213 59/241 (24%)
CG16758NP_001261330.1 PRK08202 113..391 CDD:236183 61/251 (24%)
XapA 116..391 CDD:223084 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.