DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtap and Pnp

DIOPT Version :9

Sequence 1:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006251919.1 Gene:Pnp / 290029 RGDID:1597189 Length:289 Species:Rattus norvegicus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:118/276 - (42%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIGIIGGSG-------LDDPDILEQRQ-----ERVVETPYGEPSDALIEGEINGVQCVLLARHGR 69
            ::.:|.|||       |..|...:..:     :..|:...|.    |:.|.:||..||::  .||
  Rat    26 QVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGR----LVFGFLNGRSCVMM--QGR 84

  Fly    70 KH---DIMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQTFY 131
            .|   ....|.|.:...::.|  :|...|:|:.|.|.|..:.:.|::::..|.|:......|...
  Rat    85 FHMYEGYSLSKVTFPVRVFHL--LGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPL 147

  Fly   132 DGKAQSPRGVCHLPMFPAFS--------ERTRNILLQAAKELEIPAHDKATIVTIEGPRFSSRSE 188
            .|......||    .|||.|        ::..|...|..::.|:   .:.|.:...||.|.:.:|
  Rat   148 RGPNDERFGV----RFPAMSDAYDRDMRQKAFNAWKQMGEQREL---QEGTYIMSAGPTFETVAE 205

  Fly   189 SHMFRQWGGDLINMTTCPEVVLAKEAGLLYGSVAIAT-----DYDCWRMGCEGVNVQDVL---RT 245
            |.:.|..|.|.:.|:|.|||::|:..||.....::.|     ||:    ..|..:.|:||   :.
  Rat   206 SCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYN----NLEKASHQEVLEAGKA 266

  Fly   246 FAENVIKVKKILVNAV 261
            .|:.:.:...||:.::
  Rat   267 AAQKLEQFVSILMESI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 67/276 (24%)
PNP_UDP_1 17..263 CDD:294213 67/276 (24%)
PnpXP_006251919.1 XapA 11..276 CDD:223084 65/268 (24%)
PNPH 26..280 CDD:273764 67/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.