DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6550 and Y92H12BL.4

DIOPT Version :9

Sequence 1:NP_611207.1 Gene:CG6550 / 36954 FlyBaseID:FBgn0034214 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001364796.1 Gene:Y92H12BL.4 / 190787 WormBaseID:WBGene00022365 Length:107 Species:Caenorhabditis elegans


Alignment Length:86 Identity:34/86 - (39%)
Similarity:51/86 - (59%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DIEDLISADDVKPRERYENKKTVTVRAKKRSQIRLESQEEEEKPKPTIHESVIPGT-QKVFVKTW 78
            ||||::....|..|:..|      ::.:.|.|:     .:|::|.....:|::||. |||:|:||
 Worm     2 DIEDIVGRGPVGSRDANE------IKIRTRKQV-----PKEQQPDDANVDSMVPGVGQKVWVRTW 55

  Fly    79 GCAHNNSDSEYMAGQLAAYGY 99
            ||:||.||||||:|.|...||
 Worm    56 GCSHNTSDSEYMSGLLQQAGY 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6550NP_611207.1 MiaB-like-B 72..549 CDD:273703 19/28 (68%)
UPF0004 72..151 CDD:279287 19/28 (68%)
Radical_SAM 215..413 CDD:100105
Y92H12BL.4NP_001364796.1 UPF0004 49..>79 CDD:395735 19/28 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.